Tag: Viral infection

  • Nalbandian, A. et al. Post-acute COVID-19 syndrome. Nat. Med. 27, 601–615 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Choutka, J., Jansari, V., Hornig, M. & Iwasaki, A. Unexplained post-acute infection syndromes. Nat. Med. 28, 911–923 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Narasimhan, H., Wu, Y., Goplen, N. P. & Sun, J. Immune determinants of chronic sequelae after respiratory viral infection. Sci. Immunol. 7, eabm7996 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Cheon, I. S. et al. Immune signatures underlying post-acute COVID-19 lung sequelae. Sci. Immunol. 6, eabk1741 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Vijayakumar, B. et al. Immuno-proteomic profiling reveals aberrant immune cell regulation in the airways of individuals with ongoing post-COVID-19 respiratory disease. Immunity 55, 542–556 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Phetsouphanh, C. et al. Immunological dysfunction persists for 8 months following initial mild-to-moderate SARS-CoV-2 infection. Nat. Immunol. 23, 210–216 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Jyothula, S. S. K. et al. Fulminant lung fibrosis in non-resolvable COVID-19 requiring transplantation. eBioMedicine 86, 104351 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Gagiannis, D. et al. Clinical, imaging, and histopathological features of pulmonary sequelae after mild COVID-19. Am. J. Respir. Crit. Care Med. 208, 618–621 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Yao, C. et al. Maladaptive TGF-β signals to the alveolar epithelium drive fibrosis after COVID-19 infection. Am. J. Respir. Crit. Care Med. 208, 201–204 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Xie, Y., Choi, T. & Al-Aly, Z. Association of treatment with nirmatrelvir and the risk of post–COVID-19 condition. JAMA Intern. Med. 183, 554–564 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Al-Aly, Z., Xie, Y. & Bowe, B. High-dimensional characterization of post-acute sequelae of COVID-19. Nature 594, 259–264 (2021).

    Article 
    ADS 
    CAS 
    PubMed 

    Google Scholar
     

  • Bharat, A. et al. Lung transplantation for patients with severe COVID-19. Sci. Transl. Med. 12, eabe4282 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Stewart, I. et al. Residual lung abnormalities after COVID-19 hospitalization: interim analysis of the UKILD Post-COVID-19 Study. Am. J. Respir. Crit. Care Med. 207, 693–703 (2022).

    Article 
    PubMed Central 

    Google Scholar
     

  • Bowe, B., Xie, Y. & Al-Aly, Z. Postacute sequelae of COVID-19 at 2 years. Nat. Med. 29, 2347–2357 (2023).

  • Merad, M., Blish, C. A., Sallusto, F. & Iwasaki, A. The immunology and immunopathology of COVID-19. Science 375, 1122–1127 (2022).

    Article 
    ADS 
    CAS 
    PubMed 

    Google Scholar
     

  • Bingham, G. C. et al. High-dimensional comparison of monocytes and T cells in post-COVID and idiopathic pulmonary fibrosis. Front. Immunol. 14, 1308594 (2024).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Arish, M., Qian, W., Narasimhan, H. & Sun, J. COVID-19 immunopathology: from acute diseases to chronic sequelae. J. Med. Virol. 95, e28122 (2023).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Klein, J. et al. Distinguishing features of long COVID identified through immune profiling. Nature 623, 139–148 (2023).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Vaughan, A. E. et al. Lineage-negative progenitors mobilize to regenerate lung epithelium after major injury. Nature 517, 621–625 (2015).

    Article 
    ADS 
    CAS 
    PubMed 

    Google Scholar
     

  • Kobayashi, Y. et al. Persistence of a regeneration-associated, transitional alveolar epithelial cell state in pulmonary fibrosis. Nat. Cell Biol. 22, 934–946 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Strunz, M. et al. Alveolar regeneration through a Krt8+ transitional stem cell state that persists in human lung fibrosis. Nat. Commun. 11, 3559 (2020).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Choi, J. et al. Inflammatory signals induce AT2 cell-derived damage-associated transient progenitors that mediate alveolar regeneration. Cell Stem Cell 27, 366–82 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Kumar, P. A. et al. Distal airway stem cells yield alveoli in vitro and during lung regeneration following H1N1 influenza infection. Cell 147, 525–538 (2011).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Xie, T. et al. Abnormal respiratory progenitors in fibrotic lung injury. Stem Cell Res. Ther. 13, 64 (2022).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Habermann, A. C. et al. Single-cell RNA sequencing reveals profibrotic roles of distinct epithelial and mesenchymal lineages in pulmonary fibrosis. Sci. Adv. 6, eaba1972 (2020).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Adams, T. S. et al. Single-cell RNA-seq reveals ectopic and aberrant lung-resident cell populations in idiopathic pulmonary fibrosis. Sci. Adv. 6, eaba1983 (2020).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Rendeiro, A. F. et al. Persistent alveolar type 2 dysfunction and lung structural derangement in post-acute COVID-19. Preprint at medRxiv https://doi.org/10.1101/2022.11.28.22282811 (2022).

  • Jiang, P. et al. Ineffectual type 2-to-type 1 alveolar epithelial cell differentiation in idiopathic pulmonary fibrosis: persistence of the KRT8hi transitional state. Am. J. Respir. Crit. Care Med. 201, 1443–1447 (2020).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Tsukui, T. et al. Collagen-producing lung cell atlas identifies multiple subsets with distinct localization and relevance to fibrosis. Nat. Commun. 11, 1920 (2020).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Leist, S. R. et al. A mouse-adapted SARS-CoV-2 induces acute lung injury and mortality in standard laboratory mice. Cell 183, 1070–1085 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Dinnon, K. H. et al. SARS-CoV-2 infection produces chronic pulmonary epithelial and immune cell dysfunction with fibrosis in mice. Sci. Transl. Med. 14, eabo5070 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Goplen, N. P. et al. Tissue-resident CD8+ T cells drive age-associated chronic lung sequelae after viral pneumonia. Sci. Immunol. 5, eabc4557 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Dinnon, K. H. et al. A mouse-adapted model of SARS-CoV-2 to test COVID-19 countermeasures. Nature 586, 560–566 (2020).

    Article 
    ADS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Winkler, E. S. et al. SARS-CoV-2 infection of human ACE2-transgenic mice causes severe lung inflammation and impaired function. Nat. Immunol. 21, 1327–1335 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Wei, X., Narasimhan, H., Zhu, B. & Sun, J. Host recovery from respiratory viral infection. Ann. Rev. Immunol. 41, 277–300 (2023).

    Article 
    CAS 

    Google Scholar
     

  • Wang, F. et al. Regulation of epithelial transitional states in murine and human pulmonary fibrosis. J. Clin. Invest. 133, e165612 (2023).

  • Liang, J. et al. Reciprocal interactions between alveolar progenitor dysfunction and aging promote lung fibrosis. eLife 12, e85415 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • D’Agnillo, F. et al. Lung epithelial and endothelial damage, loss of tissue repair, inhibition of fibrinolysis, and cellular senescence in fatal COVID-19. Sci. Transl. Med. 13, eabj7790 (2021).

  • Melms, J. C. et al. A molecular single-cell lung atlas of lethal COVID-19. Nature 595, 114–119 (2021).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Konkimalla, A. et al. Transitional cell states sculpt tissue topology during lung regeneration. Cell Stem Cell 30, 1486–502 (2023).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Fiege, J. K. & Langlois, R. A. Investigating influenza A virus infection: tools to track infection and limit tropism. J. Virol. 89, 6167–6170 (2015).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Katsura, H., Kobayashi, Y., Tata, P. R. & Hogan, B. L. M. IL-1 and TNFα contribute to the inflammatory niche to enhance alveolar regeneration. Stem Cell Rep. 12, 657–666 (2019).

    Article 
    CAS 

    Google Scholar
     

  • Kostura, M. J. et al. Identification of a monocyte specific pre-interleukin 1 beta convertase activity. Proc. Natl Acad. Sci. USA 86, 5227–5231 (1989).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Littlefield, K. M. et al. SARS-CoV-2-specific T cells associate with inflammation and reduced lung function in pulmonary post-acute sequalae of SARS-CoV-2. PLoS Pathog. 18, e1010359 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Krishna, B. A. et al. Spontaneous, persistent, T cell-dependent IFN-γ release in patients who progress to long COVID. Sci. Adv. 10, eadi9379 (2024).

  • Riemondy, K. A. et al. Single cell RNA sequencing identifies TGFβ as a key regenerative cue following LPS-induced lung injury. JCI Insight 5, e123637 (2019).

    Article 
    PubMed 

    Google Scholar
     

  • Nabhan, A. N., Brownfield, D. G., Harbury, P. B., Krasnow, M. A. & Desai, T. J. Single-cell Wnt signaling niches maintain stemness of alveolar type 2 cells. Science 359, 1118–1123 (2018).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Salama, C. et al. Tocilizumab in patients hospitalized with COVID-19 pneumonia. N. Engl. J. Med. 384, 20–30 (2020).

    Article 
    PubMed 

    Google Scholar
     

  • Stancil, I. T. et al. Interleukin-6-dependent epithelial fluidization initiates fibrotic lung remodeling. Sci. Transl. Med. 14, eabo5254 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Choi, J. et al. Release of Notch activity coordinated by IL-1β signalling confers differentiation plasticity of airway progenitors via Fosl2 during alveolar regeneration. Nat. Cell Biol. 23, 953–966 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Chen, B., Julg, B., Mohandas, S., Bradfute, S. B. & Force RMPT. Viral persistence, reactivation, and mechanisms of long COVID. eLife 12, e86015 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Proal, A. D. et al. SARS-CoV-2 reservoir in post-acute sequelae of COVID-19 (PASC). Nat. Immunol. 24, 1616–1627 (2023).

  • An EUA for baricitinib (olumiant) for COVID-19. Med. Lett. Drugs Ther. 62, 202–203 (2020).

  • An EUA for anakinra (kineret) for COVID-19. Med. Lett. Drugs Ther. 64, e203 (2022).

  • Goplen, N. et al. Combined sensitization of mice to extracts of dust mite, ragweed, and Aspergillus species breaks through tolerance and establishes chronic features of asthma. J. Allerg. Clin. Immunol. 123, 925–932 (2009).

    Article 
    CAS 

    Google Scholar
     

  • Major, J. et al. Endothelial AHR activity prevents lung barrier disruption in viral infection. Nature 621, 813–820 (2023).

  • Weiner, A. I. et al. ΔNp63 drives dysplastic alveolar remodeling and restricts epithelial plasticity upon severe lung injury. Cell Rep. 41, 111805 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Huang, S. et al. PPAR-γ in macrophages limits pulmonary inflammation and promotes host recovery following respiratory viral infection. J. Virol. 93, e00030-19 (2019).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Hübner, R. H. et al. Standardized quantification of pulmonary fibrosis in histological samples. Biotechniques. 44, 507–511 (2008).

    Article 
    PubMed 

    Google Scholar
     

  • Wong, L.-Y. R. et al. Eicosanoid signalling blockade protects middle-aged mice from severe COVID-19. Nature 605, 146–151 (2022).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Bankhead, P. et al. QuPath: open source software for digital pathology image analysis. Sci. Rep. 7, 16878 (2017).

    Article 
    ADS 
    PubMed 
    PubMed Central 

    Google Scholar
     

[ad_2]

Source link

  • Molecular mimicry in multisystem inflammatory syndrome in children

    [ad_1]

    Patients

    Patients were recruited through the prospectively enrolling multicentre Overcoming COVID-19 and Taking on COVID-19 Together study in the USA. All patients meeting clinical criteria were included in the study, and therefore no statistical methods were used to predetermine sample size and no blinding or randomization of subjects occurred. The study was approved by the central Boston Children’s Hospital Institutional Review Board (IRB) and reviewed by IRBs of participating sites with CDC IRB reliance. A total of 292 patients consented and were enrolled into one of the following independent cohorts between 1 June 2020 and 9 September 2021: 223 patients hospitalized with MIS-C (199 in the primary discovery cohort and 24 in a separate subsequent validation cohort), 29 patients hospitalized for COVID-19 in either an intensive care or step-down unit (referred to as ‘severe acute COVID-19’ in this study) and 45 outpatients (referred to as ‘at-risk controls’ in this study) post-SARS-CoV-2 infections associated with mild or no symptoms. The demographic and clinical data are summarized in Extended Data Tables 1–3. The 2020 US CDC case definition was used to define MIS-C51. All patients with MIS-C had positive SARS-CoV-2 serology results and/or positive SARS-CoV-2 test results by reverse transcriptase quantitative PCR. All patients with severe COVID-19 or outpatient SARS-CoV-2 infections had a positive antigen test or nucleic acid amplification test for SARS-CoV-2. For outpatients, samples were collected from 36 to 190 days after the positive test (median of 70 days after a positive test; interquartile range of 56–81 days). For use as controls in the SARS-CoV-2-specific PhIP-seq, plasma from 48 healthy, pre-COVID-19 controls were obtained as deidentified samples from the New York Blood Center. These samples were part of retention tubes collected at the time of blood donations from volunteer donors who provided informed consent for their samples to be used for research.

    DNA oligomers for SLBAs

    DNA coding for the desired peptides for use in SLBAs were inserted into split luciferase constructs containing a terminal HiBiT tag and synthesized (Twist Biosciences) as DNA oligomers and verified by Twist Biosciences before shipment. Constructs were amplified by PCR using the 5′- AAGCAGAGCTCGTTTAGTGAACCGTCAGA-3′ and 5′-GGCCGGCCGTTTAAACGCTGATCTT-3′ primer pair.

    For SNX8, the oligomers coded for the following sequences:

    EADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQELLA

    AAAAAAAAAATPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQELLA

    EADPPAAAAAAAAAAEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQELLA

    EADPPASDLPAAAAAAAAAAVQQVPAPSRMQMPQGNPLLLSHTLQELLA

    EADPPASDLPTPQAIAAAAAAAAAAAPSRMQMPQGNPLLLSHTLQELLA

    EADPPASDLPTPQAIEPQAIAAAAAAAAAAQMPQGNPLLLSHTLQELLA

    EADPPASDLPTPQAIEPQAIVQQVPAAAAAAAAAANPLLLSHTLQELLA

    EADPPASDLPTPQAIEPQAIVQQVPAPSRMAAAAAAAAAASHTLQELLA

    EADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGAAAAAAAAAAELLA

    EADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLAAAAAAAAA

    For SARS-CoV-2 nucleocapsid protein, the oligomers coded for the following sequences:

    ATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQA

    AAAAAAAAAADHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQA

    ATEGAAAAAAAAAAARNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQA

    ATEGALNTPKAAAAAAAAAANAAIVLQLPQGTTLPKGFYAEGSRGGSQA

    ATEGALNTPKDHIGTAAAAAAAAAALQLPQGTTLPKGFYAEGSRGGSQA

    ATEGALNTPKDHIGTRNPANAAAAAAAAAAGTTLPKGFYAEGSRGGSQA

    ATEGALNTPKDHIGTRNPANNAAIVAAAAAAAAAAKGFYAEGSRGGSQA

    ATEGALNTPKDHIGTRNPANNAAIVLQLPQAAAAAAAAAAEGSRGGSQA

    ATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPAAAAAAAAAAGSQA

    ATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAAAAAAAAAA

    DNA plasmids for RLBAs

    For RLBAs, DNA expression plasmids under control of a T7 promoter and with a terminal Myc–DDK tag for the desired protein were utilized. For ERFL, a custom plasmid was ordered from Twist Bioscience in which a Myc–DDK-tagged full-length ERFL sequence under a T7 promoter was inserted into the pTwist Kan High Copy Vector (Twist Bioscience). Twist Bioscience verified a sequence-perfect clone by next-generation sequencing before shipment. Upon receipt, the plasmid was sequence verified by Primordium Labs. For SNX8, a plasmid containing the Myc–DDK-tagged full-length human SNX8 under a T7 promoter was ordered from Origene (RC205847) and was sequence verified by Primordium Labs upon receipt. For KDELR1, a plasmid containing the Myc–DDK-tagged full-length human KDELR1 under a T7 promoter was ordered from Origene (RC205880) and was sequence verified by Primordium Labs upon receipt. For IL1RN, a plasmid containing the Myc–DDK-tagged full-length human IL1RN under a T7 promoter was ordered from Origene (RC218518) and was sequence verified by Primordium Labs upon receipt.

    Polypeptide pools for activation-induced marker assays

    To obtain polypeptides tiling the full-length SNX8 protein, 15-mer polypeptide fragments with 11-amino acid overlaps were ordered from JPT Peptide Technologies and synthesized. Together, a pool of 130 of these polypeptides (referred to as the ‘SNX8 pool’) spanned all known translated SNX8 (the full-length 465-amino acid SNX8 protein, as well as a unique region of SNX8 isoform 3). A separate pool was designed to cover primarily the region of SNX8 with similarity to the SARS-CoV-2 nucleocapsid protein in high resolution (referred to as the ‘high-resolution epitope pool’). This pool contained 20 10-mers with 9-amino acid overlaps tiling amino acids 44–72 (IVQQVPAPSRMQMPQGNPLLLSHTLQELL) of the full-length SNX8 protein. The sequence of each of these 150 polypeptides was verified by mass spectrometry and purity was calculated by high-performance liquid chromatography (HPLC).

    Peptides for tetramer assays

    For use in loading tetramers, three peptides were ordered from Genemed Synthesis as 9-mers. LQLPQGTTL and LQLPQGITL correspond to the region of the SARS-CoV-2 nucleocapsid protein with similarity to human SNX8 in the ancestral sequence and a minor variant, respectively. This sequence was verified by mass spectrometry and purity was calculated as 96.61% by HPLC. The other sequence, MQMPQGNPL, corresponds to the region of human SNX8 protein with similarity to the SARS-CoV-2 nucleocapsid protein. This sequence was verified by mass spectrometry and purity was calculated as 95.83% by HPLC.

    Human proteome PhIP-seq

    Human proteome PhIP-seq was performed following our previously published vacuum-based PhIP-seq protocol12 (https://www.protocols.io/view/scaled-high-throughput-vacuum-phip-protocol-ewov1459kvr2/v1).

    Our human peptidome library consists of a custom-designed phage library of 731,724 unique T7 bacteriophage each presenting a different 49-amino acid peptide on its surface. Collectively, these peptides tile the entire human proteome including all known isoforms (as of 2016) with 25-amino acid overlaps. Of the phage library, 1 ml was incubated with 1 μl of human serum overnight at 4 °C and immunoprecipitated with 25 μl of 1:1 mixed protein A and protein G magnetic beads (10008D and 10009D, Thermo Fisher). These beads were than washed, and the remaining phage–antibody complexes were eluted in 1 ml of Escherichia coli (BLT5403, EMD Millipore) at 0.5–0.7 OD and amplified by growing in a 37 °C incubator. This new phage library was then re-incubated with the serum from the same individual and the previously described protocol was repeated. DNA was then extracted from the final phage library, barcoded, PCR amplified and Illumina adaptors were added. Next-generation sequencing was performed using an Illumina sequencer (Illumina) to a read depth of approximately 1 million per sample.

    Human proteome PhIP-seq analysis

    All human peptidome analysis (except when specifically stated otherwise) was performed at the gene level, in which all reads for all peptides mapping to the same gene were summed, and 0.5 reads were added to each gene to allow inclusion of genes with zero reads in mathematical analyses. Within each individual sample, reads were normalized by converting to the percentage of total reads. To normalize each sample against background nonspecific binding, a fold change over mock-IP was calculated by dividing the sample read percentage for each gene by the mean read percentage of the same gene for the AG bead-only controls. This fold-change signal was then used for side-by-side comparison between samples and cohorts. Fold-change values were also used to calculate z scores for each patient with MIS-C compared with controls and for each control sample by using all remaining controls. These z scores were used for the logistic-regression feature weighting. In instances of peptide-level analysis, raw reads were normalized by calculating the number of reads per 100,000 reads.

    SARS-CoV-2 proteome PhIP-seq

    SARS-CoV-2 proteome PhIP-seq was performed as previously described39. In brief, 38 amino acid fragments tiling all open reading frames from SARS-CoV-2, SARS-CoV-1 and 7 other CoVs were expressed on T7 bacteriophage with 19-amino acid overlaps. Of the phage library, 1 ml was incubated with 1 μl of human serum overnight at 4 °C and immunoprecipitated with 25 μl of 1:1 mixed protein A and protein G magnetic beads (10008D and 10009D, Thermo Fisher). Beads were washed five times on a magnetic plate using a P1000 multichannel pipette. The remaining phage–antibody complexes were eluted in 1 ml of E. coli (BLT5403, EMD Millipore) at 0.5–0.7 OD and amplified by growing in 37 °C incubator. This new phage library was then re-incubated with the serum of the same individual and the previously described protocol was repeated for a total of three rounds of immunoprecipitations. DNA was then extracted from the final phage library, barcoded, PCR amplified and Illumina adaptors were added. Next-generation sequencing was then performed using an Illumina sequencer (Illumina) to a read depth of approximately 1 million per sample.

    Coronavirus proteome PhIP-seq analysis

    To account for differing read depths between samples, the total number of reads for each peptide fragment was converted to the number of reads per 100,000 (RPK). To calculate normalized enrichment relative to pre-COVID-19 controls (FC > pre-COVID-19), the RPK for each peptide fragment within each sample was divided by the mean RPK of each peptide fragment among all pre-COVID-19 controls. These FC > pre-COVID-19 values were used for all subsequent analyses as described in the text and figures.

    RLBA

    RLBAs were performed as previously described12,32. In brief, DNA plasmids containing full-length cDNA under the control of a T7 promoter for each of the validated antigens (see ‘DNA plasmids for RLBAs’ above) were verified by Primordium Labs sequencing. The respective DNA templates were used in the T7 TNT in vitro transcription/translation kit (L1170, Promega) using [35S]-methionine (NEG709A, PerkinElmer). Respective protein was column purified on Nap-5 columns (17-0853-01, GE Healthcare), and equal amounts of protein (approximately 35,000 counts per minute) were incubated overnight at 4 °C with 2.5 μl of serum or 1 μl of anti-Myc-positive control antibody (1:10 dilution; 2272S, Cell Signaling Technology). Immunoprecipitation was then performed on 25 μl of Sephadex protein A/G beads (4:1 ratio; GE17-5280-02 and GE17-0618-05, Sigma-Aldrich) in 96-well polyvinylidene difluoride filtration plates (EK-680860, Corning). After thoroughly washing, the counts per minute of immunoprecipitated protein was quantified using a 96-well Microbeta Trilux liquid scintillation plate reader (Perkin Elmer).

    SLBA

    SLBA was performed as previously described52. A detailed SLBA protocol is available on protocols.io (https://doi.org/10.17504/protocols.io.4r3l27b9pg1y/v1).

    In brief, the DNA oligomers listed above (see ‘DNA oligomers for SLBAs’) were amplified by PCR using the primer pairs listed above (see ‘DNA oligomers for SLBAs’). Unpurified PCR product was used as input in the T7 TNT in vitro transcription/translation kit (L1170, Promega) and the Nano-Glo HiBit Lytic Detection System (N3040, Promega) was used to measure relative luciferase units of translated peptides in a luminometre. Equal amounts of protein (in the range of 2 × 106–2 × 107 relative luciferase units) were incubated overnight with 2.5 μl patient sera or 1 μl anti-HiBit-positive control antibody (1:10 dilution; CS2006A01, Promega) at 4 °C. Immunoprecipitation was then performed on 25 µl of Sephadex protein A/G beads (1:1 ratio; GE17-5280-02 and GE17-0618-05, Sigma-Aldrich) in 96-well polyvinylidene difluoride filtration plates (EK-680860, Corning). After thoroughly washing, luminescence was measured using the Nano-Glo HiBit Lytic Detection System (N3040, Promega) in a luminometre.

    Activation-induced marker assay

    PBMCs were obtained from ten patients with MIS-C and ten controls for use in the activation-induced marker assay. PBMCs were thawed, washed, resuspended in serum-free RPMI medium and plated at a concentration of 1 × 106 cells per well in a 96-well round-bottom plate. For each individual, PBMCs were stimulated for 24 h with either the SNX8 pool (see above) at a final concentration of 1 mg ml−1 per peptide in 0.2% DMSO or a vehicle control containing 0.2% DMSO only. For four of the controls and two of the patients with MIS-C, there were sufficient PBMCs for an additional stimulation condition using the SNX8 high-resolution epitope pool (see above) also at a concentration of 1 mg ml−1 per peptide in 0.2% DMSO for 24 h. Following the stimulation, cells were washed with FACS buffer (Dulbecco’s PBS without calcium or magnesium, 0.1% sodium azide, 2 mM EDTA and 1% FBS) and stained with the following antibody panel each at 1:100 dilution for 20 min at 4 °C, and then flow cytometry analysis was immediately performed.

    For the antibody panel: anti-CD3 Alexa 647 (clone OKT3, 317312, BioLegend), anti-CD4 Alexa 488 (clone OKT4, 317420, BioLegend), anti-CD8 Alexa 700 (clone SK1, 344724, BioLegend), anti-OX-40 (also known as CD134) PE-Dazzle 594 (clone ACT35, 350020, BioLegend), anti-CD69 PE (clone FN-50, 310906, BioLegend), anti-CD137 (also known as 4-1BB) BV421 (clone 4B4-1, 309820, BioLegend), anti-CD14 PerCP-Cy5 (clone HCD14, 325622, BioLegend), anti-CD16 PerCP-Cy5 (clone B73.1, 360712, BioLegend), anti-CD19 PerCP-Cy5 (clone HIB19, 302230, BioLegend) and Live/Dead Dye eFluor 506 (65-0866-14, Invitrogen).

    The activation-induced marker analysis was performed using FlowJo software using the gating strategy shown in Extended Data Fig. 7a. All gates were fixed within each condition of each sample. Activated CD4 T cells were defined as those that were co-positive for OX40 and CD137. Activated CD8 T cells were defined as those that were co-positive for CD69 and CD137. Gating thresholds for activation were defined by the outer limits of signal in the vehicle controls allowing for up to two outlier cells. Frequencies were calculated as a percentage of total CD3+ cells (T cells). Two MIS-C samples had insufficient total events captured by flow cytometry (total of 5,099 and 4,919 events, respectively) and were therefore removed from analysis.

    Initial tetramer assay

    For the initial tetramer assay, see Extended Data Fig. 4a. PBMCs from two patients with MIS-C with HLA-A*02:01 (HLA typed from PAXgene RNAseq, one confirmed by serotyping), one patient with MIS-C with HLA-B*35:01 (HLA typed from PAXgene RNAseq) and three at-risk controls with HLA-A*02.01 (all three identified by serotyping, two of three confirmed by PAXgene RNAseq HLA typing; the other sample did not have genomic DNA available for genotyping) were thawed, washed and put into culture with media containing recombinant human IL-2 at 10 ng ml−1 in 96-well plates. The peptide fragments (details above) LQLPQGITL and MQMPQGNPL were then added to PBMCs to a final concentration of 10 mg ml−1 per peptide and incubated (37 °C at 5% CO2) for 7 days.

    Following the 7 days of incubation, a total of eight pHLA class I tetramers were generated from UV-photolabile biotinylated monomers, four each from HLA-A*02:01 and HLA-B*35:01 (NIH Tetramer Core). Peptides were loaded via UV peptide exchange. Tetramerization was carried out using streptavidin conjugated to fluorophores PE and APC or BV421 followed by quenching with 500 µM d-biotin, similar to our previously published methods44,53. Tetramers were then pooled together as shown below:

    For the HLA-A*02:01 pool, the MADS (LQLPQGITL)-loaded PE tetramer, MADS (LQLPQGITL)-loaded APC tetramer, SNX8 (MQMPQGNPL)-loaded PE tetramer and SNX8 (MQMPQGNPL)-loaded BV421 tetramer were used, all with HLA-A*02:01 restriction.

    For the HLA-B*35:01 pool, the MADS (LQLPQGITL)-loaded PE tetramer, MADS (LQLPQGITL)-loaded APC tetramer, SNX8 (MQMPQGNPL)-loaded PE tetramer and SNX8 (MQMPQGNPL)-loaded BV421 tetramer were used, all with HLA-B*35:01 restriction.

    All PBMCs were then treated with 100 nM dasatinib (StemCell) for 30 min at 37 °C followed by staining (no wash step) with the respective tetramer pool corresponding to their HLA restriction (final concentration of 2–3 µg ml−1) for 30 min at 25 °C. Cells were then stained with the following cell-surface markers each at 1:100 dilution for 20 min, followed by immediate analysis on a flow cytometer.

    For the surface markers: anti-CD8 Alexa 700 (clone SK1, 357404, BioLegend), anti-CD4 PerCP-Cy5 (clone SK1, 300530, BioLegend), anti-CD14 PerCP-Cy5 (clone HCD14, 325622, BioLegend), anti-CD16 PerCP-Cy5 (clone B73.1, 360712, BioLegend), anti-CD19 PerCP-Cy5 (clone HIB19, 302230, BioLegend) and Live/Dead Dye eFluor 506 (65-0866-14, Invitrogen). Streptavidin was conjugated to PE (S866, Invitrogen), APC (S868, Invitrogen) and BV421 (405225, BioLegend).

    The gating strategy is outlined in Extended Data Fig. 7b. A stringent tetramer gating strategy was used to identify cross-reactive T cells, in which CD8+ T cells were required to be triple positive for PE, APC and BV421 labels (that is, a single CD8 T cell bound to PE-conjugated LQLPQGITL and/or PE-conjugated MQMPQGNPL in addition to APC-conjugated LQLPQGITL and BV421-conjugated MQMPQGNPL).

    Serotyping was performed using an anti-HLA-A2 antibody (1:100 dilution; FITC anti-human HLA-A2 antibody, clone BB7.2, 343303, BioLegend), and pertinent results are shown in Extended Data Fig. 7c.

    Assembly of easYmer monomers and fold testing

    For the assembly of HLA class I pHLA easYmer monomers and fold testing, see Fig. 4. Unfolded, biotinylated easYmer monomers (Immudex) were obtained for HLA-A*02:01 and HLA-A*02:06. SARS-CoV-2 MADS (LQLPQGITL), SARS-CoV-2 Wuhan (LQLPQGTTL) and human SNX8 (MQMPQGNPL) peptides were commercially synthesized (Genscript), diluted to 1 mM in ddH2O or DMSO, and loaded onto each easYmer allele according to the manufacturer’s instructions at 18 °C for 48 h. Proper pHLA monomer formation and MADS and SNX8 peptide-binding strength were evaluated for each HLA using a ‘β2m fold test’ relative to negative (no peptide; unloaded monomer) and positive (strong binding peptide; CMV pp65 495–503 (NLVPMVATV)) controls as per the manufacturer’s protocol. In brief, peptide-loaded monomers with a concentration of 500 nM were serially diluted to 9 nM, 3 nM and 1 nM in dilution buffer (1× PBS with 5% glycerol; G5516, Sigma-Aldrich) and incubated with streptavidin beads (6–8 μm; SVP-60-5, Spherotech) at 37 °C for 1 h to allow binding of stable complexes to beads, then washed three times with FACS buffer (1× PBS, 0.5% BSA (A7030, Sigma-Aldrich) and 2 mM EDTA (15575-038, Thermo Fisher Scientific)). Samples were then stained with PE-conjugated anti-human β2m antibody (clone BBM.1, sc-13565, Santa Cruz Biotech) at 1:200 for 30 min at 4 °C, washed three times with FACS buffer and analysed on a 5 Laser 16UV-16V-14B-10YG-8R AURORA spectral cytometer (Cytek). pHLA-binding strength positively correlated with stability and concentration of the pHLA–β2m complex. Therefore, the geometric mean fluorescence intensity of anti-β2m staining in this assay reports on the strength of the pHLA binding compared with the positive and negative controls. We classified binding strength for each HLA and peptide combination based on the fold change in anti-β2m geometric mean fluorescence intensity over the no-peptide negative control at 9 nM. Strong binders were defined at more than 10-fold higher, moderate binders at more than 3-fold, weak binders at more than 1.5-fold and non-binders at less than 1.5-fold change over the negative control. Flow cytometry data were analysed using FlowJo version 10.7.2 software (BD Biosciences).

    pHLA tetramer assembly

    For the pHLA tetramer assembly, see Fig. 4. pHLA tetramers were assembled from HLA-A*02:01 and HLA-A*02:06 easYmer monomers (Immudex) with confirmed peptide binding to SARS-CoV-2 MADS (LQLPQGITL), Wuhan (LQLPQGTTL) and SNX8 (MQMPQGNPL) peptides according to the manufacturer’s instructions. In brief, fluorochrome-conjugated streptavidin (0.2 mg ml−1, PE, 405203, BioLegend; 0.2 mg ml−1, APC, 405207, BioLegend; and BV421, 405226, BioLegend) was added to loaded monomers at 8 ng per 1 μl pHLA complex (500 nM) in three volumes. After each 1/3 volume addition, samples were mixed and incubated for 15 min at 4 °C in the dark. Assembled tetramers were stored at 4 °C in the dark until use.

    Enhanced peptide-specific T cell expansion

    For enhanced peptide-specific T cell expansion, see Fig. 4. PBMCs from MIS-C confirmed participants with HLA-A*02:01 or HLA-A*02:06 were obtained for peptide-specific expansion according to published methods54 before single-cell sorting of tetramer-positive T cells. On expansion day 0, PBMCs were thawed, counted and seeded onto 96-well round-bottom plates at 100,000 cells per well in 200 μl antigen-presenting cell differentiation media (X-VIVO 15 serum-free haematopoietic cell medium (04-418Q, Lonza) supplemented with human GM-CSF (1,000 IU ml−1; 130-095-372, Miltenyi Biotec), human IL-4 (500 IU ml−1; 204-IL-010, R&D Systems) and human Flt3-L (50 ng ml−1; 308-FKN-025, R&D Systems) final concentrations) and incubated for 24 h at 37 °C and 5% CO2. On day 1, 100 μl cell supernatant was replaced with 100 μl Adjuvant Solution (X-VIVO 15 supplemented with R848 (10 μM; tlrl-r848-5, InvivoGen), lipopolysaccharide (Salmonella minnesota; 100 ng ml−1; tlrl-smlps, InvivoGen) and human IL-1β (10 ng ml−1; 201-LB-010, R&D Systems) final concentrations) and pooled MADS (LQLPQGITL) and SNX8 (MQMPQGNPL) peptides at a final concentration of 10 μM each. No-peptide control wells were set up for each sample by adding a 1:2 dilution of DMSO in H2O to match the peptide volume and diluent. Cells were incubated for 24 h at 37 °C and 5% CO2. On days 2, 4, 7 and 9, 100 μl supernatant was replaced with 100 μl T cell expansion solution: RP-10 (RPMI 1640 (22400-089, Gibco), 10% heat-inactivated human serum AB (100-512, Gemini Bio-Products), 10 mM HEPES, 0.1 mg ml−1 gentamicin (15750-060, Thermo Fisher Scientific) and 1× GlutaMAX (35050-061, Gibco)) supplemented with human IL-2 (10 IU ml−1; 202-IL-050, R&D Systems), human IL-7 (10 ng ml−1; 207-IL-025, R&D Systems) and human IL-15 (10 ng ml−1; 200-15, PeproTech) final concentrations. On day 10, peptide-expanded cells from an individual participant were pooled; cells from no-peptide controls were collected separately.

    Single-cell index sorting

    Unexpanded PBMCs (direct ex vivo) or peptide-expanded T cells were obtained, washed in 1× PBS and treated with 100 nM dasatinib (CDS023389, Sigma-Aldrich) in 1× PBS for 30 min at 37 °C and 5% CO2 (ref. 55). Cells were then pelleted and resuspended in 50 μl FACS buffer (1× PBS and 0.04% BSA) supplemented with human TruStain FcX blocking buffer (1:10 dilution; 422302, BioLegend), 500 μM d-biotin (B20656, Thermo Fisher Scientific) and a unique tetramer cocktail containing MADS–tetramer–PE (1:10 dilution), MADS–tetramer–APC (1:10 dilution), SNX8–tetramer–PE (1:10 dilution) and SNX8–tetramer–BV421 (1:10 dilution) based on participant HLA type (A*02:01 and A*02:06). Cells were incubated in the dark at 25 °C for 1 h followed by direct addition of 50 μl (100 μl total volume) of FACS supplemented with 500 μM d-biotin and an antibody cocktail containing FITC-conjugated anti-human CD3 (1:20 dilution; clone OKT3, lot B390808, 317306, BioLegend), BV605-conjugated anti-human CD8 (1:20 dilution; clone SK1, lot B371925, 344742, BioLegend), BV510-conjugated anti-human CD4 (1:20 dilution; clone OKT4, lot B375526, 317444, BioLegend), BV510-conjugated anti-human CD14 (1:20 dilution; clone 63D3, lot B390770, 367124, BioLegend), BV510-conjugated anti-human CD16 (1:20 dilution; clone 3G8, lot B372132, 302048, BioLegend), BV510-conjugated anti-human CD19 (1:20 dilution; clone HIB19, lot B390665, 302242, BioLegend) and Ghost Dye Violet 510 Viability Dye (1:400 dilution; lot D0870061322133, 13-0870-T500, Tonbo Biosciences) for 30 min in the dark at 4 °C. Cells were then pelleted, washed twice with 4 ml FACS buffer (containing 500 μM d-biotin), suspended in 500 μl FACS (containing 500 μM d-biotin) and passed through a 45-μM filter before proceeding to single-cell sorting on a Sony SY3200 cell sorter. Individual, live, BV510 dump gate (CD4, CD14, CD16 and CD19)-negative, CD3+CD8+ T lymphocytes were gated to distinguish tetramer triple-positive cells (PE+APC+BV421+) as described in Extended Data Fig. 7d and sorted into individual wells of a 384-well plate loaded with Superscript VILO master mix (11754250, Thermo Fisher Scientific). After sorting, plates were centrifuged at 500g and stored at −80 °C until processing.

    Paired TCRαβ amplification and sequencing

    Single-cell paired TCRα and TCRβ chain library preparation and sequencing was performed on T cells sorted into 384-well index plates as previously described56. In brief, after reverse transcription of cells sorted in Superscript VILO master mix, cDNA underwent two rounds of nested multiplex PCR amplification using a mix of human V-segment-specific forward primers and human TRAC and TRBC segment-specific reverse primers (see Supplementary Table 1 for primer details). Resulting TCRα and TCRβ amplicons were sequenced on an Illumina MiSeq at 2 × 150-bp read length.

    Cell lines

    All cultured cell lines were maintained at 37 °C and 5% CO2 in a humidified incubator. HEK 293T cells (CRL-3216, American Type Culture Collection) were purchased from the American Type Culture Collection and verified commercially. HEK 293T cells were cultured in DMEM (11965-092, Gibco) supplemented with 10% FBS (16140-071, Gibco), 2 mM l-glutamine (25030-081, Gibco) and 100 U ml−1 penicillin–streptomycin (15140-122, Gibco). 2D3 Jurkat J76.7 cells57,58 (TCR-null, CD8+) expressing an NFAT–eGFP reporter were kindly provided by F. Fujiki and were cultured in RPMI 1640 (22400-089, Gibco) supplemented with 10% FBS, 2 mM l-glutamine and 100 U ml−1 penicillin–streptomycin. All cell lines were confirmed to be mycoplasma negative during the course of experiments.

    TCR repertoire analysis

    TCR similarity networks were constructed as previously described49,59. In brief, to measure the distance between TCRαβ clonotypes, we used the TCRdist algorithm implementation from the CoNGA v0.1.2 Python package47. Further analysis was performed using the R language for statistical computing, with merging and subsetting of data performed using the dplyr v1.1.4 package. TCR similarity networks were built using stringdist v0.9.12 and igraph v2.0.3 (ref. 60) R packages, and visualized using gephi v0.9.7 (ref. 61) software.

    TCR reconstruction and cloning

    Full-length TCRαβ sequences were reconstructed from V/J gene usage and CDR3 sequences using Stitchr v1.0.0 (ref. 62) for each index-sorted T cell. TCRα and TCRβ chain sequences were modified to use murine constant regions and joined by a 2A element from thosea asigna virus (T2A). A sequence encoding mCherry was additionally appended by a 2A element from porcine teschovirus (P2A) as a fluorescent marker of transduction. The full-length gene fragment encoding TCRβ–T2A–TCRα–P2A–mCherry was synthesized and cloned commercially (Genscript) into the lentiviral vector pLVX-EF1α-IRES-Puro (631253, Takara).

    Generation of TCR-expressing Jurkat cells

    To generate transducing particles packaging individual TCRs of interest (Fig. 4c), HEK 293T cells were transduced with a pLVX lentiviral vector encoding a unique TCRαβ–mCherry insert, psPAX2 packaging plasmid (plasmid #12260, Addgene) and an pMD2.G envelope plasmid (plasmid #12259, Addgene) at a ratio of 4:3:1. At 24 h and 48 h post-transfection, viral supernatants were harvested, passed through a 0.45-µm SFCA filter (723-9945, Thermo Fisher Scientific), concentrated using Lenti-X Concentrator (631232, Takara) and stored at −80 °C as single-use aliquots. To generate TCR-expressing Jurkat cell lines (Jurkat-TCR+), 2D3 Jurkat J76.7 cells (TCR-null, CD8+, NFAT–eGFP reporter) were seeded in a 12-well tissue-culture-treated plate at 1 × 106 cells per well in complete RPMI (RPMI 1640, 10% FBS, 2 mM l-glutamine, 100 U ml−1 penicillin–streptomycin) and transduced by adding concentrated lentivirus dropwise to each well. At 48–72 h post-tranduction, puromycin was added at 1 μg ml−1 and cultured for 1 week to select for transduced cells. Jurkat-TCR+ cell lines were validated for the presence of correctly folded TCR on the cell surface by flow cytometry using a monoclonal antibody targeting the mouse TCRβ constant region (APC/Fire750-conjugated; clone H57-597, 109246, BioLegend; Extended Data Fig. 5a). Flow cytometry data were collected on a custom-configured BD Fortessa using FACSDiva software (v8.0.1; Becton Dickinson) and analysed using FlowJo version 10.7.2 software (BD Biosciences).

    Specificity validation of putative cross-reactive TCR sequences

    The specificity of TCR-expressing Jurkat T cell lines was validated by tetramer staining using the same reagents used for single-cell sorting PBMCs (above). In brief, 1 × 106 Jurkat-TCR+ cell lines or untransduced Jurkat J76.7 (TCR-null; background control) were washed in 1× PBS and resuspended in 50 μl FACS buffer (1× PBS and 0.04% BSA) and a unique tetramer cocktail containing MADS–tetramer–PE (1:10 dilution), MADS–tetramer–APC (1:10 dilution), SNX8–tetramer–PE (1:10 dilution) and SNX8–tetramer–BV421 (1:10 dilution) based on the restricting HLA type (A*02:01 and A*02:06). Tetramers conjugated to the Wuhan peptide sequence (LQLPQGTTL), including Wuhan–tetramer–PE (1:10 dilution) and Wuhan–tetramer–APC (1:10 dilution), were also tested. A second set of wells were set up in which each individual tetramer was used to stain cells. Cells were incubated in the dark at 25 °C for 30 min after which 50 µl of FACS buffer containing Ghost Dye Violet 510 Viability Dye (1:400 dilution; lot D0870061322133, 13-0870-T500, Tonbo Biosciences) was added for an additional 30-min incubation in the dark at 25 °C. Cells were then washed twice with 1 ml FACS buffer, suspended in 300 μl FACS and analysed by flow cytometry on a custom-configured BD Fortessa using FACSDiva software (v8.0.1; Becton Dickinson). Cell population gating and fluorescence analysis was performed using FlowJo version 10.7.2 software (BD Biosciences) as described in Extended Data Fig. 7e.

    scRNA-seq analysis

    To assess the cell-type specificity in a relevant disease context, we analysed SNX8 expression from a single-cell sequencing of PBMC samples from patients with severe, mild or asymptomatic COVID-19 infection, influenza virus infection and healthy controls48. Gene expression data from 59,572 pre-filtered cells were downloaded from the Gene Expression Omnibus database under accession GSE149689 for analysis and downstream processing with scanpy v1.10.0 (ref. 63). Cells with (1) less than 1,000 total counts, (2) less than 800 expressed genes, and (3) more than 3,000 expressed genes were filtered out as further quality control, leaving 42,904 cells for downstream analysis. Gene expression data were normalized to have 10,000 counts per cell and were log1p transformed. Highly variable genes were calculated using the scanpy function highly_variable_genes using Seurat flavor with the default parameters (min_mean = 0.0125, max_mean = 3, and min_disp = 0.5)64. Only highly variable genes were used for further analysis. The total number of counts per cell was regressed out, and the gene expression matrix was scaled using the scanpy function scale with max_value = 10. Dimensionality reduction was performed using principal components analysis with 50 principal components. Batch balanced k-nearest neighbours, implemented with scanpy’s function bbknn, was used to compute the top neighbours and normalize batch effects65. The batch-corrected cells were clustered using the Leiden algorithm and projected into two dimensions with uniform manifold approximation and projection for visualization. Initial cluster identity was determined by finding marker genes with differential expression analysis performed using a Student’s t-test on log1p-transformed raw counts with the scanpy function rank_genes_groups66,67.

    Statistical methods

    All statistical analysis was performed in Python using the Scipy Stats package unless otherwise indicated. For comparisons of distributions of PhIP-seq enrichment between two groups, a non-parametric Kolmogorov–Smirnov test was utilized. For logistic-regression feature weighting, the Scikit-learn package68 was used, and logistic-regression classifiers were applied to z-scored PhIP-seq values from individuals with MIS-C versus at-risk controls. A liblinear solver was used with L1 regularization, and the model was evaluated using a five-fold cross-validation (four of the five for training, and one of the five for testing). For the RLBAs and SLBAs, first an antibody index was calculated as follows: (sample value – mean blank value)/(positive control antibody values – mean blank values). For the alanine mutagenesis scans, blank values of each construct were combined, and a single mean was calculated. A normalization function was then applied to the experimental samples only (excluding antibody-only controls) to create a normalized antibody index ranging from 0 to 1. Comparisons between two groups of samples were performed using a Mann–Whitney U-test. An antibody was considered to be ‘positive’ when the normalized antibody index in a sample was greater than 3 s.d. above the mean of controls. When comparing two groups of normally distributed data, a Student’s t-test was performed.

    Reporting summary

    Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.

    [ad_2]

    Source link

  • Immunological memory diversity in the human upper airway

    [ad_1]

  • Sette, A. & Crotty, S. Immunological memory to SARS‐CoV‐2 infection and COVID‐19 vaccines. Immunol. Rev. 310, 27–46 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Allie, S. R. & Randall, T. D. Resident memory B cells. Viral Immunol. 33, 282–293 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Topol, E. J. & Iwasaki, A. Operation nasal vaccine-lightning speed to counter COVID-19. Sci. Immunol. 7, eadd9947 (2022).

    Article 
    PubMed 

    Google Scholar
     

  • Zheng, M. Z. M. & Wakim, L. M. Tissue resident memory T cells in the respiratory tract. Mucosal Immunol. 15, 379–388 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Poon, M. M. L. et al. Tissue adaptation and clonal segregation of human memory T cells in barrier sites. Nat. Immunol. 24, 309–319 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Domínguez Conde, C. et al. Cross-tissue immune cell analysis reveals tissue-specific features in humans. Science 376, eabl5197 (2022).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Clark, R. A. Resident memory T cells in human health and disease. Sci. Transl. Med. 7, 269rv1 (2015).

    Article 
    ADS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Lange, J., Rivera-Ballesteros, O. & Buggert, M. Human mucosal tissue-resident memory T cells in health and disease. Mucosal Immunol. 15, 389–397 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Thome, J. J. C. et al. Spatial map of human T cell compartmentalization and maintenance over decades of life. Cell 159, 814–828 (2014).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Gray, J. I. & Farber, D. L. Tissue-resident immune cells in humans. Annu. Rev. Immunol. 40, 195–220 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Masopust, D. & Soerens, A. G. Tissue-resident T cells and other resident leukocytes. Annu. Rev. Immunol. 37, 521–546 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Snyder, M. E. et al. Generation and persistence of human tissue-resident memory T cells in lung transplantation. Sci. Immunol. 4, eaav5581 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Weisel, N. M. et al. Comprehensive analyses of B-cell compartments across the human body reveal novel subsets and a gut-resident memory phenotype. Blood 136, 2774–2785 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Havenar-Daughton, C., Lee, J. H. & Crotty, S. Tfh cells and HIV bnAbs, an immunodominance model of the HIV neutralizing antibody generation problem. Immunol. Rev. 275, 49–61 (2017).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Havenar-Daughton, C. et al. Normal human lymph node T follicular helper cells and germinal center B cells accessed via fine needle aspirations. J. Immunol. Methods 479, 112746 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Alsoussi, W. B. et al. SARS-CoV-2 Omicron boosting induces de novo B cell response in humans. Nature 617, 592–598 (2023).

    Article 
    ADS 
    CAS 
    PubMed 

    Google Scholar
     

  • Leggat, D. J. et al. Vaccination induces HIV broadly neutralizing antibody precursors in humans. Science 378, eadd6502 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Victora, G. D. & Nussenzweig, M. C. Germinal Centers. Annu. Rev. Immunol. 40, 413–442 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Xu, Q. et al. Adaptive immune responses to SARS-CoV-2 persist in the pharyngeal lymphoid tissue of children. Nat. Immunol. 24, 186–199 (2023).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Kumar, B. V. et al. Human tissue-resident memory T cells are defined by core transcriptional and functional signatures in lymphoid and mucosal sites. Cell Rep. 20, 2921–2934 (2017).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Kusnadi, A. et al. Severely ill COVID-19 patients display impaired exhaustion features in SARS-CoV-2-reactive CD8+ T cells. Sci. Immunol. 6, eabe4782 (2021).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Meckiff, B. J. et al. Imbalance of regulatory and cytotoxic SARS-CoV-2-reactive CD4+ T cells in COVID-19. Cell 183, 1340–1353.e16 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Schmiedel, B. J. et al. Single-cell eQTL analysis of activated T cell subsets reveals activation and cell type-dependent effects of disease-risk variants. Sci. Immunol. 7, eabm2508 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • FitzPatrick, M. E. B. et al. Human intestinal tissue-resident memory T cells comprise transcriptionally and functionally distinct subsets. Cell Reports 34, 108661 (2021).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Crotty, S. T follicular helper cell biology: a decade of discovery and diseases. Immunity 50, 1132–1148 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Mudd, P. A. et al. SARS-CoV-2 mRNA vaccination elicits a robust and persistent T follicular helper cell response in humans. Cell 185, 603–613.e15 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Nolan, S. et al. A large-scale database of T-cell receptor beta (TCRb) sequences and binding associations from natural and synthetic exposure to SARS-CoV-2. Preprint at Research Square https://doi.org/10.21203/rs.3.rs-51964/v1 (2020).

  • Goncharov, M. et al. VDJdb in the pandemic era: a compendium of T cell receptors specific for SARS-CoV-2. Nat. Methods 19, 1017–1019 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Rowntree, L. C. et al. SARS-CoV-2-specific T cell memory with common TCRαβ motifs is established in unvaccinated children who seroconvert after infection. Immunity 55, 1299–1315.e4 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Pogorelyy, M. V. et al. Resolving SARS-CoV-2 CD4+ T cell specificity via reverse epitope discovery. Cell Rep. Med. 3, 100697 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Tan, H.-X. et al. Lung-resident memory B cells established after pulmonary influenza infection display distinct transcriptional and phenotypic profiles. Sci. Immunol. 7, eabf5314 (2022).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Barker, K. A. et al. Lung-resident memory B cells protect against bacterial pneumonia. J. Clin. Invest. 131, e141810 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Gregoire, C. et al. Viral infection engenders bona fide and bystander subsets of lung-resident memory B cells through a permissive mechanism. Immunity 55, 1216–1233.e9 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Allie, S. R. et al. The establishment of resident memory B cells in the lung requires local antigen encounter. Nat. Immunol. 20, 97–108 (2019).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Ehrhardt, G. R. A. et al. Expression of the immunoregulatory molecule FcRH4 defines a distinctive tissue-based population of memory B cells. J. Exp. Med. 202, 783–791 (2005).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Ehrhardt, G. R. A. et al. Discriminating gene expression profiles of memory B cell subpopulations. J. Exp. Med. 205, 1807–1817 (2008).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • King, H. W. et al. Single-cell analysis of human B cell maturation predicts how antibody class switching shapes selection dynamics. Sci. Immunol. 6, eabe6291 (2021).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Zumaquero, E. et al. IFNγ induces epigenetic programming of human T-bethi B cells and promotes TLR7/8 and IL-21 induced differentiation. eLife 8, e41641 (2019).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Knox, J. J. et al. T-bet+ B cells are induced by human viral infections and dominate the HIV gp140 response. JCI Insight 2, e92943 (2017).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Duan, M. et al. Understanding heterogeneity of human bone marrow plasma cell maturation and survival pathways by single-cell analyses. Cell Rep. 42, 112682 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Lim, J. M. E. et al. SARS-CoV-2 breakthrough infection in vaccinees induces virus-specific nasal-resident CD8+ and CD4+ T cells of broad specificity. J. Exp. Med. 219, e20220780 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Dan, J. M. et al. Immunological memory to SARS-CoV-2 assessed for up to 8 months after infection. Science 371, eabf4063 (2021).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Grifoni, A. et al. Targets of T cell responses to SARS-CoV-2 coronavirus in humans with COVID-19 disease and unexposed individuals. Cell 181, 1489–1501.e15 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Dan, J. M. et al. Recurrent group A Streptococcus tonsillitis is an immunosusceptibility disease involving antibody deficiency and aberrant T FH cells. Sci. Transl. Med. 11, eaau3776 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Ramirez, S. I. et al. Bamlanivimab therapy for acute COVID-19 does not blunt SARS-CoV-2–specific memory T cell responses. JCI Insight 7, e163471 (2022).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Yu, E. D. et al. Development of a T cell-based immunodiagnostic system to effectively distinguish SARS-CoV-2 infection and COVID-19 vaccination status. Cell Host Microbe 30, 388–399.e3 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Grifoni, A. et al. SARS-CoV-2 human T cell epitopes: adaptive immune response against COVID-19. Cell Host Microbe 29, 1076–1092 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Hao, Y. et al. Integrated analysis of multimodal single-cell data. Cell 184, 3573–3587.e29 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Korotkevich, G. et al. Fast gene set enrichment analysis. Preprint at bioRXiv https://doi.org/10.1101/060012 (2016).

  • Lee, J. H. et al. Long-primed germinal centres with enduring affinity maturation and clonal migration. Nature 609, 998–1004 (2022).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Holla, P. et al. Shared transcriptional profiles of atypical B cells suggest common drivers of expansion and function in malaria, HIV, and autoimmunity. Sci. Adv. 7, eabg8384 (2021).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Lopes De Assis, F. et al. Tracking B cell responses to the SARS-CoV-2 mRNA-1273 vaccine. Cell Rep. 42, 112780 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Yermanos, A. et al. Platypus: an open-access software for integrating lymphocyte single-cell immune repertoires with transcriptomes. NAR Genom. Bioinform. 3, lqab023 (2021).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Gupta, N. T. et al. Change-O: a toolkit for analyzing large-scale B cell immunoglobulin repertoire sequencing data. Bioinformatics 31, 3356–3358 (2015).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Vander Heiden, J. A. et al. pRESTO: a toolkit for processing high-throughput sequencing raw reads of lymphocyte receptor repertoires. Bioinformatics 30, 1930–1932 (2014).

    Article 

    Google Scholar
     

  • Gupta, N. T. et al. Hierarchical clustering can identify B cell clones with high confidence in Ig repertoire sequencing data. J. Immunol. 198, 2489–2499 (2017).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Nouri, N. & Kleinstein, S. H. Somatic hypermutation analysis for improved identification of B cell clonal families from next-generation sequencing data. PLoS Comput. Biol. 16, e1007977 (2020).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Ye, J., Ma, N., Madden, T. L. & Ostell, J. M. IgBLAST: an immunoglobulin variable domain sequence analysis tool. Nucleic Acids Res. 41, W34–W40 (2013).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Giudicelli, V., Chaume, D. & Lefranc, M.-P. IMGT/GENE-DB: a comprehensive database for human and mouse immunoglobulin and T cell receptor genes. Nucleic Acids Res. 33, D256–D261 (2005).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Hoehn, K. B. et al. Repertoire-wide phylogenetic models of B cell molecular evolution reveal evolutionary signatures of aging and vaccination. Proc. Natl Acad. Sci. USA 116, 22664–22672 (2019).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Hoehn, K. B. et al. Human B cell lineages associated with germinal centers following influenza vaccination are measurably evolving. eLife 10, e70873 (2021).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Hoehn, K. B., Pybus, O. G. & Kleinstein, S. H. Phylogenetic analysis of migration, differentiation, and class switching in B cells. PLoS Comput. Biol. 18, e1009885 (2022).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Raybould, M. I. J., Kovaltsuk, A., Marks, C. & Deane, C. M. CoV-AbDab: the coronavirus antibody database. Bioinformatics 37, 734–735 (2021).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Kaku, C. I. et al. Evolution of antibody immunity following Omicron BA.1 breakthrough infection. Nat. Commun. 14, 2751 (2023).

    Article 
    ADS 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Chen, E. C. et al. Convergent antibody responses to the SARS-CoV-2 spike protein in convalescent and vaccinated individuals. Cell Rep. 36, 109604 (2021).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Barnes, C. O. et al. Structures of human antibodies bound to SARS-CoV-2 spike reveal common epitopes and recurrent features of antibodies. Cell 182, 828–842.e16 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Tarke, A. et al. SARS-CoV-2 vaccination induces immunological T cell memory able to cross-recognize variants from Alpha to Omicron. Cell 185, 847–859.e11 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Hastie, K. M. et al. Potent Omicron-neutralizing antibodies isolated from a patient vaccinated 6 months before Omicron emergence. Cell Rep. 42, 112421 (2023).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Lee, J. H. et al. A broadly neutralizing antibody targets the dynamic HIV envelope trimer apex via a long, rigidified, and anionic β-hairpin structure. Immunity 46, 690–702 (2017).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Zhang, Z. et al. Humoral and cellular immune memory to four COVID-19 vaccines. Cell 185, 2434–2451.e17 (2022).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • [ad_2]

    Source link

  • Human SARS-CoV-2 challenge uncovers local and systemic response dynamics

    [ad_1]

    Study participants and design

    Sixteen healthy adults aged 18–30 years, with no evidence of a previous SARS-CoV-2 infections or vaccinations (seronegative), were included for scRNA-seq sample processing and analysis from the wider cohort (36 participants) enrolled as part of the human SARS-CoV-2 challenge study, pioneered by the government task force, Imperial College London, Royal Free London NHS Foundation Trust, University College London and hVIVO7. These participants were enrolled as part of cohorts 5 and 6, from June to August 2021. Additionally, 20 healthy adults were included as part of the same study (earlier cohorts)7, and blood and nasal (mid-turbinate) samples were processed for bulk RNA-seq as previously described12 (see Supplementary Table 1q for an overview of the bulk RNA-seq validation cohort and samples included). Of these participants, ten individuals received pre-emptive remdesivir as previously described7. Volunteers were tested for the presence of anti-SARS-CoV-2 protein antibodies using a MosaiQ COVID-19 antibody microarray (Quotient) before enrolment and excluded based on a positive test, as well as on risk factors assessed by clinical history, physical examinations and screening assessments. See ref. 7 for the full list of inclusion and exclusion criteria and for further details regarding the challenge set-up and ethics. In brief, written informed consent was obtained from all volunteers before screening and study enrolment. The clinical study was registered with ClinicalTrials.gov (identifier NCT04865237). This study was conducted in accordance with the protocol, the Consensus ethical principles derived from international guidelines, including the Declaration of Helsinki and Council for International Organizations of Medical Sciences International Ethical Guidelines, applicable ICH Good Clinical Practice guidelines, and applicable laws and regulations. The screening protocol and main study were approved by the UK Health Research Authority—Ad Hoc Specialist Ethics Committee (reference: 20/UK/2001 and 20/UK/0002).

    Participant 11, who fulfilled enrolment criteria, was later found to have low pre-inoculation levels of neutralizing and spike-binding antibodies (see serum antibody titre methods below). This individual was classified as an abortive infection based on virus kinetics (see virology method below). When tested, the exclusion of this individual was found not to alter any of our conclusions (data not shown).

    The participants were followed for 1 year after inoculation, with continued samples and metadata collected for the use in future studies and to benefit the research community. No participants enrolled in the study were observed to present with any long-COVID symptoms at this final time point (1 year), which included an interview by a study clinician to assess for symptoms and a complete physical examination. The UPSIT scores for all participants had returned to baseline and no other symptoms were reported, with physiological observations and physical examination of vital signs were all seen to be normal (including temperature, heart rate, blood pressure, respiratory rate, saturation of peripheral oxygen level [SpO2], spirometry and electrocardiogram). Of note, although most symptoms were seen to spontaneously resolve themselves, one participant (participant 2) out of the six total who reported anosmia or dysosmia as part of the single-cell cohort received additional smell training and a short course of steroids (28 days after inoculation)7. This study, however, focused primarily on the first 28 days after inoculation (with the exception of 46 days for one participant as noted below, see sample collection below).

    Of note, after the participants were discharged from quarantine and before their day 28 follow-up (when additional blood samples were collected), two participants reported either to have had their first SARS-CoV-2 vaccine (participant 9) or a community infection (participant 7). In brief, participant 9 had their first vaccine on day 14 after inoculation (2 weeks before the day 28 sample was taken). Participant 7 tested positive before their day 28 visit was due. The follow-up was therefore delayed by 2 weeks, resulting in the day 28 sample for this participant instead being taken at day 46 after inoculation. ELISpot performed on this participant revealed a response in the day 28 and day 90 samples (data not shown). Moreover, participant 8 tested positive on day 29 after inoculation, a day after their day 28 sample was taken. However, for this participant, the ELISpot showed no response at day 28 and a small response at day 90. See Extended Data Fig. 1a for overview of the samples and time points included from each participant. These individuals and time points were found not to alter any of our conclusions.

    Challenge virus

    Participants were intranasally inoculated with a wild-type pre-Alpha SARS-CoV-2 challenge virus (SARS-CoV-2/human/GBR/484861/2020) at dose 10 TCID50 at day 0. A volume of 100 µl per naris was pipetted between both nostrils and the participant was asked to remain supine (face and torso facing up) for 10 min, followed by 20 min in a sitting position wearing a nose clip after inoculation to ensure maximum contact time with the nasal and pharyngeal mucosa. Mid-turbinate nose and throat samples were collected twice daily using flocked swabs and placed in 3 ml of viral transport medium (BSV-VTM-001, Bio-Serv) that was aliquoted and stored at −80 °C to evaluate viral kinetics (infection status) as described in the section ‘Virology’ below. Participants remained in quarantine for a minimum of 14 days after inoculation until the following discharge criteria were met: two consecutive daily nose and/or throat swabs with no viral detection or a qPCR Ct value > 33.5 and no viable virus by overnight incubation viral culture with detection by immunofluorescence. For details of the protocol and ethics used within the human SARS-CoV-2 challenge study, see the ‘Challenge virus’ section of the methods in ref. 7.

    Sample collection for scRNA-seq cohort

    Nasopharyngeal swabs

    Samples were collected at the Royal Free Hospital by trained healthcare providers at 7 time points: day –1 (pre-inoculation) and days 1, 3, 5, 7, 10 and 14 after inoculation. The participants were asked to clear any mucus from their nasal cavities, and nasopharyngeal samples were collected using FLOQSwabs (Copan flocked swabs, ref. 501CS01) inserted along the nasal septum, above the floor of the nasal passage to the nasopharynx until a slight resistance was felt. The swab was then rotated in this position in both directions for 10 s and slowly removed while still rotating and immediately stored in a pre-cooled cryovial on wet ice containing freeze medium (90% heat-inactivated FBS and 10% dimethyl sulfoxide (DMSO)). On wet ice, the cryovials were transferred to the hospital chutes where they were sent down to the laboratory (<2 min at room temperature), placed in a slow-cooling device (Mr. Frosty Freezing Container, Thermo Fisher Scientific) and stored at −20 °C until all samples were collected, at which point they were moved to −80 °C freezers for at least 48 h for optimum freezing. Samples were moved and stored in liquid nitrogen for later processing.

    PBMC isolation from peripheral blood

    Peripheral whole blood was collected at the Royal Free Hospital in EDTA tubes at 5 time points: day –1 (pre-inoculation) and days 3, 5, 10, 14 and 28 after inoculation. Each day, the blood was transferred at room temperature to Imperial College London for fresh isolation and collection of PBMCs by means of Histopaque Ficoll separation (Merck, H8889-500ML). The peripheral whole blood was first diluted 1:1 with 1× PBS (Merck, D8662-500ML) before being gently overlaid onto a maximum of 15 ml of Histopaque, at a ratio of 2:1 (blood to Histopaque). The samples were then centrifuged at 400g (with no breaks) for 30 min at room temperature and the PBMC white buffer layer was collected, washed (with PBS about 50 ml) and spun down (400g for 10 min at room temperature), before the supernatant was carefully discarded and the cell pellet was resuspended in 10 ml PBS. The cells were filtered using a 40 or 70 μm cell strainer and then both the cell number and viability were assessed using Trypan Blue. The cells were further centrifuged (400g for 10 min) and resuspended in the required volume of cell freezing medium (90% FBS (Sigma, F9665-500ML) and 10% DMSO (Sigma, D2650-100ML)), before being cryopreserved at −80 °C using a slow-cooling device. The blood and nasopharyngeal samples were collected within 2 h of each other.

    Clinical assessments

    Participants were carefully monitored and assessed daily using an array of blood tests, spirometry, electrocardiograms and clinical assessments (vital signs, symptom diaries and clinical examination). Full details of all the safety and clinical data collected with the human SARS-CoV-2 challenge study can be obtained in the methods in ref. 7, with an overview of metadata and demographics for the 16 participants enrolled for the scRNA-seq part of this study (up to 28 day after inoculation) in Supplementary Table 1g.

    Virology

    From 24 h after inoculation, twice daily samples (swabs) were taken at 12-h intervals from both the nose (mid-turbinate) and throat (pharyngeal) to assess and quantify the viral kinetics of each participant before and after inoculation (morning and afternoon) for their quarantine period (minimum 14 days, which was extended with the continued detection of virus). These were measured using two independent assays: (1) RT–qPCR with N gene primers/probes adapted from the Centers for Disease Control and Prevention protocol34 (updated 29 May 2020); and (2) quantitative culture by focus forming assay (FFA). For full details of each assay and statistical analysis, refer to the methods in ref. 7.

    The lower limit of quantification (LLOQ) for RT–qPCR was 3 log10 copies per ml, with positive detections less than the LLOQ assigned a value of 1.5 log10 copies per ml and undetectable samples assigned a value of 0 log10 copies per ml. Only samples in which participants presented with consecutive positive RT–qPCR results were further tested using the FFA assay. In the FFA, the LLOQ was 1.27 FFU ml−1. Viral detection less than the LLOQ was assigned 1 log10 FFU ml−1, and undetectable samples were assigned 0 log10 FFU ml−1.

    Infection intervals for each participant were calculated based on the time of the first and last RT–qPCR test with detectable virus (across the nose and/or throat), time points in which tests below the LLOQ (1.5) were also counted if they occurred <2 days of a quantifiable (>LLOQ) test result.

    An overview of the virology in each of the 16 participants included in the single-cell cohort (<28 days after inoculation) is provided in Extended Data Fig. 1b,c, with CT and FFA (virus titre) values provided in Supplementary Table 1a,b,h,i.

    Infection group nomenclature

    A sustained laboratory-confirmed infection was defined as quantifiable RT–qPCR detection greater than the LLOQ from mid-turbinate and/or throat (pharyngeal) swabs on 2 or more consecutive 12-h time points, starting from 24 h after inoculation and up to discharge from quarantine. Participants for whom only a single or two non-consecutive RT–qPCR tests returned quantifiable results (>LLOQ) were classified as transient infections. Participants for whom no RT–qPCR tests returned quantifiable results (>LLOQ) were classified as abortive infections (Extended Data Fig. 1b and Supplementary Table 1a,b,h,i). The nomenclature of sustained, transient and abortive infection groups was carefully chosen based on the hypotheses that viral exposure through inoculation leads to sustained, transient and aborted viral replication, respectively, in these participants. Here sustained infection events resemble typical COVID-19 cases, whereby after viral infection, the virus spreads through the upper airway tissues and replicated to highly detectable levels. Transient infections represent a new group of cases whereby we propose that successful but limited replicative infection has taken place, leading to viral loads that were borderline detectable. Finally, we propose that non-replicative viral infection (that is, abortive viral infections) has taken place in the participants who belong to the abortive infection group.

    Nasopharyngeal swab dissociation and processing for scRNA-seq

    Following freezing, nasopharyngeal swabs were transferred to a category level 3 facility at University College London, stored and processed in batches of 7–8 samples at a time to a single-cell suspension. All work was carried out in a MSC class I hood in compliance with standard category level 3 safety practices. The dissociation and collection of cells from nasopharyngeal swabs was carried out in accordance with the previously described protocol35,36, with minor modifications. This approach involves multiple parallel washes and digestion steps using both the nasopharyngeal swab and collected freezing and wash medium to help ensure maximum cell recovery. First, samples are exposed to DTT for 15 min, followed by an Accutase digestion step for 30 min, before cells from the same sample (collected directly from the swab or the freezing medium and washes from that swab) are quenched, pooled and filtered before checking cell number and viability.

    In brief, samples were rapidly thawed (tube A) and the liquid collected in an empty 15 ml Falcon tube (tube B). The cryovial, lid and swab was then carefully rinsed three times with 1 ml warm RPMI 1640 medium, which was added dropwise to the 15 ml tube while gently swirling the tube to slowly dilute the DMSO from the freezing medium to help prevent the cells bursting. After waiting 1 min, the tube (tube B) was then topped up with an extra 2 ml of warm RPMI 1640 medium and centrifuged at 400g for 5 min at 4 °C. The cell pellet was then resuspended in RPMI 1640 and 10 mM DTT (Thermo Fisher, R0861), and incubated for 15 min on a thermomixer (37 °C, 700 r.p.m.), centrifuged as above and the supernatant was aspirated and the cell pellet was resuspended in 1 ml Accutase (Merck, A6964-500ML). This was then incubated for a further 30 min on the thermomixer (37 °C, 700 r.p.m.).

    In parallel to the processing of the cell freezing medium and washes above, the swab was moved to a new 1.5 ml Eppendorf tube (tube C) containing 1 ml RPMI 1640 and 10 mM DTT and placed on the thermomixer (37 °C, 700 r.p.m.) for 15 min. In accordance with the steps above, the swab was next transferred to a new 1.5 ml Eppendorf (tube D) containing 1 ml Accutase and incubated with agitation (700 r.p.m.) at 37 °C. The 1 ml RPMI 1640 and 10 mM DTT from the nasopharyngeal swab incubation (in tube C) was centrifuged at 400g for 5 min at 4 °C to pellet cells, the supernatant was discarded, and the cell pellet was resuspended in 1 ml Accutase and incubated for 30 min at 37 °C with agitation (700 r.p.m.).

    Following the Accutase digestion step, all cells were combined (tubes B, C and D) and filtered using a 70 μm nylon strainer (pre-wetted with 3 ml quenching medium: RPMI 1640, 10% FBS and 1 mM EDTA (Invitrogen, 1555785-038)) in a 50 ml conical tube (tube E). The filter, tubes and swab were then further thoroughly rinsed with quenching medium to collect all cells, and the washes were combined. The dissociated, filtered cells (tube E) were then centrifuged at 400g for 5 min at 4 °C, and supernatant discarded. The cell pellet was resuspended in residual volume (about 500 µl) and transferred to a new 1.5 ml Eppendorf tube (tube F). Tube E was then washed with a further 500 µl of RPMI 1640 with 10% FBS and combined with tube F, centrifuged as above, the supernatant removed and the cells resuspended in 20 µl RPMI 1640 and 10% FBS. Using Trypan Blue, total cell counts and viability were assessed. The cell concentration was adjusted for 7,000 targeted cell recovery according to the 10x Chromium manual before loading onto a 10x chip (between 700 and 1,000 cells per µl) and processing immediately for 10x 5′ single-cell capture using a Chromium Next GEM Single Cell V(D)J Reagent kit v.1.1 (Rev E Guide). For samples in which fewer than 13,200 total cells were recovered, all cells were loaded.

    Note that owing to the sample type, necessary freezing process and no access to a class 3 flow facility to sort viable cells, the majority of the samples processed were seen to have low viability (ranging from 5.4% to 57.85%, with the average viability of samples processed being 26.89%).

    PBMC CITE-seq staining for single-cell proteogenomics

    Frozen PBMC samples were thawed and processed in batches of 16 to enable a carefully designed pooling strategy. Here each sample was pooled twice into two distinct pools containing up to four PBMC samples per pool from mixed time points. Note that only one sample from each donor was ever pooled together at a time to assist with subsequent demultiplexing. This pooling strategy was used to help remove and correct for any protocol-based batch effects.

    In brief, PBMC samples were rapidly thawed at 37 °C in a water bath. Warm RPMI 1640 medium (20–30 ml) containing 10% FBS (RPMI 1640 and FBS) was added slowly to the cells before centrifuging at 300g for 5 min. This was followed by a wash in 5 ml RPMI 1640 and FBS. The PBMC pellet was collected, and the cell number and viability were determined using Trypan Blue.

    PBMCs from 4 different donors were then pooled together (1.25 × 105 PBMCs from each donor) to make up 5.0 × 105 cells in total. The remaining cells were used for DNA extraction (Qiagen, 69504). The pooled PBMCs were resuspended in 22.5 µl cell staining buffer (BioLegend, 420201) and blocked by incubation for 10 min on ice with 2.5 µl Human TruStain FcX block (BioLegend, 422301). The PBMC pool was then stained with TotalSeq-C Human Cocktail, V1.0 antibodies (BioLegend, 399905) according to the manufacturer’s instructions (1 vial per pool). For a full list of TotalSeq-C antibodies (130 antibodies and 7 isotype controls) refer to Supplementary Table 1j. Following a 30-min incubation period with the TotalSeq-C Human Cocktail V1.0 antibodies (at 4 °C in the dark), the PBMCs were topped up using cell staining buffer and centrifuged down to a pellet (500g for 5 min at 4 °C), discarding the supernatant. The pellet was then resuspended and washed in the same manner 2 more times using the resuspension buffer (0.05% BSA in HBSS), before finally being resuspended in 20–30 µl resuspension buffer and counted again. The PBMC pools were then processed immediately for 10x 5′ single-cell capture (Chromium Next GEM Single Cell V(D)J Reagent kit v.1.1 with Feature Barcoding technology for cell Surface Protein-Rev D protocol). A total of 25,000 cells were loaded from each pool onto a 10x chip.

    PBMC Dextramer staining for SARS-CoV-2 antigen-specific T cell enrichment and single-cell sequencing

    To further validate and investigate the SARS-CoV-2 antigen-specific T cell populations in our single-cell dataset, day 10, 14 and 28 post-inoculation PBMCs samples from all 16 participants were further enriched and processed for single-cell sequencing using a multi-allele panel of 44 SARS-CoV-2 antigen-specific dCODE Dextramers (10x compatible) (Immudex, see Supplementary Table 1k for full panel). This panel includes five antigen-specific T-cell populations, spanning four MHC class I and one MHC class II alleles (covering a total of 15 participants; see Supplementary Table 1l) and several negative controls. Samples were then stained with several FACS antibodies (for monocyte and T cells) and sorted using a MACSQuant Tyto cell sorter (Miltenyi Biotec), after which PE-dCODE Dextramer-positive cells were collected and processed for 10x 5′ single-cell capture. This enabled the quantification of paired clonal TCR sequence and TCR specificity by overlaying single-cell V(D)J expression onto dCODE Dextramer-positive cell clusters.

    The Dextramer staining protocol was taken from Immudex and optimized and adapted to suit our samples and pooling and staining strategy. In brief, the PBMC samples were thawed in batches of 7–8 samples and the cell number and viability for each sample calculated using Trypan Blue as described above. All cells from each sample were then pooled together in a fresh 1.5 ml Eppendorf tube. Note that the pooling strategy here was such that only one sample per participant or donor was used per pool to enable subsequent demultiplexing by genotype, with each pool containing a mixture of time points to help reduce batch effect. To ensure the collection of as many cells as possible, each of the original sample tubes was then washed with 200 µl staining buffer (1× PBS pH 7.4 containing 5% heat-inactivated FBS (Thermo Fisher Scientific, 10500064) and 0.1 g l–1 herring sperm DNA (Thermo Fisher Scientific, 15634017)) and added to the pool. The tube was then topped up to 1.4 ml with staining buffer and centrifuged down to a pellet (400g for 5 min at 4 °C). The supernatant was carefully removed and the cell pellet gently resuspended in a total of 30–40 µl staining buffer, depending on pellet size, ready for staining.

    In parallel, the dCODE Dextramer master mix was prepared (in the dark) as per the manufacturer’s protocol. To help avoid aggregates, each individual Dextramer reagent was first microcentrifuged at full speed for 5 min before adding 2 µl from each dCODE Dextramer specificity to a low-bind nucleus-free 1.5 ml Eppendorf tube (Eppendorf, 30108051) containing 8.8 μl 100 μM d-Biotin (Avidity Science, BIO200) (0.2 µl d-Biotin per number of dCODE Dextramer specificity i.e., 44).The dCODE Dextramer master mix was mixed by gently pipetting before the total volume (96.8 µl) was added to the resuspended cells. The sample was then thoroughly mixed and incubated at room temperature for 30 min in the dark. Following the addition of anti-human CD14-FITC (BioLegend, 325603) and CD3-APC (BioLegend, 300458) (at 1:50) the cells were incubated for a further 20 min (at room temperature in the dark) before being topped up to 1.4 ml with wash buffer (1× PBS pH 7.4 containing 5% heat-inactivated FBS). The cells were centrifuged down to a pellet (400g for 5 min at 4 °C) and the supernatant discarded. The wash step was then repeated 2 times, with the latter using the addition of 1.4 ml wash buffer and 1:5,000 DAPI (Sigma) as live/dead stain. The supernatant was removed and the cell pellet resuspended in 4 ml FACS buffer (1× PBS, 1% FBS, 25 mM HEPES (Thermo Fisher Scientific, 15630-056) and 1 mM EDTA). The samples were then filtered (35 µm nylon mesh cell strainer) and PE dCODE Dextramer-positive cells were sorted using a MACSQuant Tyto cell sorter per the manufacturer’s guidelines (settings: mix speed = 800 r.p.m., chamber temperature = 4 °C, pressure = 150 hPA, noise threshold = 14.40, trigger threshold = off). Note, in order to collect as many cells as possible during sorting, the entire sample was run on the MACSQuant Tyto, with the negative run through collected and re-run a second time to ensure that no true positives were lost. See Extended Data Fig. 8d for the gating strategy for sorting. The PE dCODE Dextramer-positive cells were then collected, centrifuged (400g for 5 min at 4 °C) and resuspended in resuspension medium before counting the cells. The entire sample was then processed for 10x 5′ single cell capture (Chromium Next GEM Single Cell V(D)J Reagent kit v.1.1 with Feature Barcoding technology for cell Surface Protein-Rev D protocol). For cases when more than 25,000 cells were collected, the sample was split equally and loaded over two lanes.

    To provide additional controls, participants with non-compatible HLA types, including one volunteer (participant_4) matching none of the HLA types for the multi-allele dCODE Dextramer panel, were also processed and used to determine background noise.

    Library generation and sequencing

    A Chromium Next GEM Single Cell 5′ V(D)J Reagent kit (v.1.1 chemistry) was used for scRNA-seq library construction for all nasopharyngeal swab samples, and a Chromium Next GEM Single Cell V(D)J Reagent kit v.1.1 with Feature Barcoding technology for cell surface proteins was used for PBMCs, both to process the PBMCs stained with the CITE-seq antibody panel and the dCODE Dextramer (10x compatible) panel. GEX and V(D)J libraries were prepared according to the manufacturer’s protocol (10x Genomics) using individual Chromium i7 sample indices. Additional TCR γ/δ enriched libraries were generated based on an in-house protocol as previously described37. The cell surface protein libraries were created according to the manufacturer’s protocol with slight modifications used for the creation of libraries generated from the CITE-seq antibody panel. These included doubling the SI primer amount per reaction and reducing the number of amplification cycles to 7 during the index PCR to avoid the daisy chain effect. GEX, V(D)J and the CITE-seq-derived cell surface protein indexed libraries were pooled at a ratio of 1:0.1:0.4 and sequenced on a NovaSeq 6000 S4 Flowcell (paired-end, 150 bp reads), aiming for a minimum of 50,000 paired-end reads per cell for GEX libraries and 5,000 paired-end reads per cell for V(D)J and cell surface protein libraries. The Dextramer-derived cell surface protein indexed libraries were submitted at a ratio of 0.1.

    Single-cell genomics data alignment

    scRNA-seq and CITE-seq data from PBMCs were jointly aligned against the GRCh38 reference that 10x Genomics provided with CellRanger (v.3.0.0), and alignment was performed using CellRanger (v.4.0.0). CITE-seq antibody-derived tag (ADT) barcodes were aligned against a barcode reference provided by the supplier, which we annotated to add informative protein names and made available in our GitHub repository (https://github.com/Teichlab/COVID-19_Challenge_Study). scRNA-seq data from nasopharyngeal swab samples were aligned against the same reference using STARSolo (v.2.7.3a) and post-processed with an implementation of emptydrops extracted from CellRanger (v.3.0.2). To detect viral RNA in infected cells, we added 21 viral genomes including pre-Alpha SARS-CoV-2 (NC_045512.2) to the abovementioned reference genomes for RNA-seq alignment, as previously described6. Single-cell αβ TCR and BCR data were aligned using CellRanger (v.4.0.0) with the accompanying GRCh38 V(D)J reference that 10x Genomics provided. Single-cell γδ TCR data were aligned against the GRCh38 reference that 10x Genomics provided with CellRanger (v.5.0.0), using CellRanger (v.6.1.2).

    Single-cell genomics data processing

    Both scRNA-seq and ADT-seq data were corrected using SoupX38 to remove free-floating and background RNAs and ADTs. To correct ADT counts, SoupX 1.5.2 parameters soupQuantile and tfidfMin parameters were set to 0.25 and 0.2, respectively, and lowered by decrements of 0.05 until the contamination fraction was calculated using the autoEstCont function. SoupX on RNA data was performed using default settings. To confidently annotate SARS-CoV-2-infected cells, we used SoupX-corrected viral RNA counts to remove false positives due to freely floating SARS-CoV-2 virions. However, when quantifying the amount of reads per cell in Fig. 2h and their distribution over the viral genome in Fig. 2f, we used the raw counts and sequencing data. To profile the distribution of viral reads, we removed PCR duplicates from the aligned BAM files that STARSolo produced with MarkDuplicates in picard (https://broadinstitute.github.io/picard/) and tallied the location within the SARS-CoV-2 genome using the start of each sequencing read. Aligned scRNA-seq data were imported from the filtered_feature_bc_matrix folder into Seurat (v.4.1.0) for processing, keeping only cells with at least 200 RNA features detected. Nasopharyngeal cells and PBMCs with more than 50% and 10% of the counts coming from mitochondrial genes, respectively, were excluded. SoupX-corrected gene expression and ADT counts were normalized by dividing it by the total counts per cell and multiplying by 10 000, followed by adding one and a natural-log transformation (log(1p)).

    Demultiplexing and patient identity assignment

    Each PBMC sample was pooled twice into two distinct pools containing up to four PBMC samples per pool, followed by CITE-seq and single-cell V(D)J sequencing as described above. Souporcell (v.2.0)39 was used to demultiplex each pool based on the genotype differences between the mixed samples. Souporcell analyses were performed with the skip_remap parameter enabled and using the common SNP database that was provided by the software. We used two complementary approaches to confidently assign participant identity to each Souporcell cluster. First we compared the cluster genotypes with SNP array derived genotyping data, generated for all participants and performed using the Affymetrix UK Biobank Axiom Array kit by Cambridge Genomic Services. Second, the combinations of samples within each pool was unique, which enabled assignment of participant identity based on the presence of unique participant-specific combinations of identical genotypes in two separate pools. This multiplexing and replication strategy furthermore enabled us to distinguish library specific batch effects from participant specific effects in downstream analyses.

    Doublet detection

    We used the output from Souporcell to identify ground-truth doublets in PBMCs by selecting droplets that contained two genotypes from different participants. We then included these ground-truth doublets into the iterative rounds of subclustering and cell-state annotation to look for doublet specific clusters that emerged, which we then subsequently removed. Doublets in the nasopharyngeal data were removed during iterative rounds of subclustering and cell-state annotation by identifying cell clusters that expressed marker genes from multiple distinct cell types.

    Clustering and cell-type annotation

    Principal component analysis was run on corrected gene expression counts from selected hypervariable genes, and the first 30 principal components were selected to construct a nearest neighbour graph and UMAP embedding. We used harmony40 to perform batch correction on the PBMC data on the sequencing library identity to remove technical batch effects. Leiden clustering41 performed at resolutions of 0.5, 1, 4 and 32 on nearest neighbour graphs and embeddings created with 500, 1,000, 2,000, 4,000, 6,000 and 8,000 selected hypervariable genes (excluding TCR and BCR genes) were used to perform iterative rounds of cell-type annotation based on marker gene expression and subsetting of clusters to obtain a highly granular cell state annotation. We used previously described cell-type marker genes5,6 to define cell types. Our cell-type annotation was furthermore guided by predicted cell-type labels using models provided in CellTypist42 and custom-trained models based on previously described annotations5,6.

    Single-cell TCR and BCR data processing

    Aligned single-cell BCR and αβ TCR sequencing data were imported in scirpy43 to obtain a cell by TCR or BCR formatted table, which was then added to Seurat objects containing gene expression data. Aligned single-cell γδ TCR data were reannotated using Dandelion (v.0.2.4)44.

    Differential gene expression and gene ontology analysis

    We used DESeq2 (ref. 45) to identify significantly changing genes and gene sets. Samples were pseudobulked on cell state and sample, and we used a Wald test to compute adjusted P values. To identify genes associated with infection outcome at day –1, we fitted gene expression from pre-infection samples on cell type, sex and infection outcome. We also included sequencing library identity as a covariate in the differential expression analyses on PBMCs. To quantify interferon stimulation, we used a previously published gene signature6, and we used the ‘AddModuleScore’ function from Seurat to quantify its expression per cell. Cells were classified as interferon stimulated if the module score was higher than 0.5, and significance was determined by a Mann–Whitney U-test on module scores, which was corrected for the multiple testing hypothesis using the Bonferroni approach.

    Integration of five COVID-19 studies

    Transcriptomic data from refs. 5,6,31,32,33 were processed using the single-cell analysis Python workflow Scanpy46. Each dataset was individually filtered following best practices outlined in ref. 47 (between 200 and 3,500 genes per cell, less than 10% mitochondrial genes expressed per cell, genes expressed in fewer than 3 cells, other parameters at default). The gene sets were reduced to their intersection before combining datasets. Cells came from a total of 602 individuals, with 325 patients with acute COVID-19, 110 patients convalescing from COVID-19, 114 healthy participants and 53 patients in hospital without COVID-19 (controls) (Supplementary Table 1d). This resulted in an integrated embedding containing 946,584 T cells with resolved TCR from 494 samples, made up of 455 donors of which 240 were patients with acute COVID-19, 82 were patients convalescing from COVID-19, 88 healthy participants and 45 patients in hospital without COVID-19 (Supplementary Table 1e). The total number of donors in the integrated object is smaller, as only samples with matching V(D)J sequencing data were kept. A probabilistic scVI model (2 hidden layers, 128 hidden nodes, 20-dimensional latent space, negative binomial gene likelihood, other parameters at default48) was trained on the data to map cells to a shared latent space and visualized using UMAP.

    Identification of activated TCR clonotype groups using Cell2TCR

    To identify TCR clonotype groups, we used tcrdist3 (ref. 49) with the provided human references to compute a sparse representation of the distance matrices for all identified TRA and TRB CDR3 sequences, with the radius parameter set to 150. We then summed the distances for TRA and TRB to obtain a combined distance matrix. Next, we iterated over possible TCR distance thresholds between 5 and 150 with increments of 5 to compute TCR clonotype groups at each threshold. We then generated a distance adjacency graph of TCRs from different T cells with a distance lower than the threshold, which was clustered to identify TCR clonotype groups using leiden41 clustering through the igraph package50, at a resolution of 1 and using the RBConfigurationVertexPartition partition. To find the optimal distance threshold at which only TCRs that recognize the same antigen are grouped together, we quantified clonotype group contamination at each threshold using two approaches. First, we assumed that T cells that were annotated as naive should not participate in an expanded clonotype group, and quantified the proportion of naive T cells in each clonotype group to determine the largest threshold at which we observed minimal participation of naive T cells. Second, we assumed that CD4+ T cells and CD8+ T cells should never be part of the same TCR clonotype group, so we set out to quantify the proportion of CD4+ and CD8+ mixing in each clonotype group to find the largest threshold at which mixing is minimal. Both approaches revealed the same optimal threshold of 35, at which both naive T cell participation and CD4+ and CD8+ mixing is minimal, which we then used for downstream analyses. To identify activated TCR clonotype groups, we assumed that these groups should include activated T cells and that we should at least detect multiple independent TCR clonotypes that seemed to be raised against the same antigen at the same time. We therefore selected clonotype groups that contained at least one participating activated T cell and that contained at least two unique CDR3 nucleotide sequences.

    Identification of activated BCR clonotype groups

    To identify BCR clonotype groups that were activated during infection, we used a similar approach as described above for T cells. Instead of using tcrdist to compute distances, we used the Levenshtein distance and iterated over possible thresholds between 1 and 20 to find an optimal threshold by quantifying naive B cell participation. This revealed that a Levenshtein distance of 2 is optimal to identify BCR clonotype groups that only contain B cells that recognize the same antigen. To identify activated BCR clonotype groups, we assumed that these groups should include antibody secreting B cells (plasmablasts and plasma cells) and that we should at least detect multiple independent BCRs clonotypes that seem to be raised against the same antigen at the same time. We therefore selected clonotype groups that contained at least one participating antibody secreting B cell and that contained at least three unique CDR3 nucleotide sequences.

    Generation of V(D)J logos

    TCR and BCR logos were generated by providing the CDR3 amino acid sequences of each clonotype group to the ggseqlogo R package51 or the logomaker Python package52. When clonotype groups contained CDR3 amino acid sequences of variable lengths, we selected the sequences with the most frequently occurring length within each group for visualization purposes only.

    GLMMs of cell-state compositional changes over time

    The relative abundance of cells per cell type in each sample was modelled using a GLMM with a Poisson outcome. When technical replicates were available (most of the PBMC samples), these were modelled as separate samples. We modelled participant identifiers, days since inoculation and sequencing library identifiers (of multiplexed libraries), as random effects to overcome collinearity between these factors. The effect of each clinical or technical factor on cell-type composition was estimated by the interaction term with the cell type. The glmer function in the lme4 package implemented on R was used to fit the model. The standard error of the variance parameter for each factor was estimated using the numDeriv package. The conditional distribution of the fold change estimate of a level of each factor was obtained using the ranef function in the lme4 package. The log-transformed fold change is relative to the pre-inoculation time point (day –1). The significance of the fold change estimate was measured by the local true sign rate, which is the probability that the estimated direction of the effect is true, that is, the probability that the true log-transformed fold change is greater than 0 if the estimated mean is positive (or less than 0 if the estimated mean is negative). We calculated P values using a two-sample Z-test using the estimated mean and standard deviation of the distribution of the effect (log-transformed fold change). P values were converted into FDRs using the Benjamini–Hochberg method.

    Gaussian processes regression and latent variable models to infer time since viral exposure

    To infer time from cell-state abundance, we first generated a logistic regression model using CellTypist42 to predict PBMC or nasopharyngeal cell states based on the highly detailed manually annotates cell states presented in this work. CellTypist models were trained and used under default parameters, with check_expression set to false, balance_cell_type set to true, feature_selection set to true, and max_iter set to 150. We next built a predictive model to infer time since viral exposure using the PBMC data presented in this work as a training dataset. We used the above mentioned publicly available PBMC data from five studies as a test dataset to predict time since viral exposure. Because we were specifically interested in comparing time since viral exposure to reported time since onset of symptoms in varying disease severities, we excluded samples for which these features were unknown. To ensure that the cell-state proportions in the training and test dataset were similar, we used our CellTypist model on both datasets to predict relative cell-state frequencies, which were used as input for our time prediction model. To account for participant-to-participant heterogeneity and continuous variation in the timeline of immune responses, we first constructed a Gaussian process latent variable model53 to smooth the time since viral exposure in the training dataset. We applied the Pyro implementation of this model54 across all predicted cell state abundances, and restricted the model to 2,000 iterations and a single latent variable that was initialized on the square root transformed time since inoculation. This resulted in an accurate recapitulation of the mean time since inoculation while smoothing outliers. We next used each predicted cell state as a task input to generate a multi-task Gaussian process regression model55 to predict the smoothened time since inoculation using GPyTorch56. We used the Adam optimizer and allowed for as many iterations for the loss in marginal log likelihood to reach zero. We next predicted the cell state compositions across the entire tested timeline (day –1 to day 28) and compared these cell state compositions to those in our query dataset as predicted by our CellTypist model. Last, we selected the time point at which predicted cell-state composition had the lowest mean squared error compared with the observed cell-state composition.

    Matching clonotype groups to antigen–TCR database

    We computated the fold change enrichment of SARS-CoV-2-specific TCRs in activated T cell populations compared with other T cell populations. After 10 random draws of n = 5,000 unique clones of both populations, the median fold change = 4.99, median P = 0.00044.

    Bulk TCR sequencing and processing

    Total RNA was extracted from whole blood samples collected in Tempus Blood RNA tubes (Thermo Fisher, 4342792) using the manufacturer’s protocol. TCR α and β genes were sequenced using a pipeline that introduces UMIs attached to individual cDNA molecules using single-stranded DNA ligation. The UMI enables correction for sequencing error PCR bias, and provides a quantitative and reproducible method of repertoire analysis. Full details for both the experimental TCR sequencing library preparation57,58 and the subsequent TCR annotation (V, J and CDR3 annotation) using Decombinator (v.4)59 are published. The Decombinator software is freely available at GitHub (https://github.com/innate2adaptive/Decombinator).

    Memory formation analysis

    T cell phenotypes (naive, activated, effector and memory) were recorded for an antigen-specific TCR clone at different time points throughout infection. TCR clones were filtered by having an activated label at least once, being observed in at least two samples, one of which had to be at day 28. Unique TCR clones are distinguished by colour and numbered with their clone_id identifier. Error bands are drawn when the same clone appeared with several distinct cell-type labels, and the size of the error band informs their relative ratios.

    Quantifying TCR diversity restriction in phenotypic clusters using coincidence analysis

    To quantify the diversity of TCRs found within different phenotypic clusters, we determined the probability with which two distinct clonotypes within a cluster share an identical CDR3 amino acid sequence60. For visualization, we normalized these probabilities by the same quantity calculated over the complete data regardless of phenotype. This ratio of probability of coincidences provides a stringent measure of convergent functional selection of distinct clonotypes that share the same TCR. The analysis is based on clonotypes defined by distinct nucleotide sequences of the hypervariable regions, and does not make direct use of clonal abundance as these can also reflect TCR-independent lineage differences. We focused our analysis on conventional T cells only, considered only cells with at least one valid functional α-chain and β-chain, and kept only a single chain for each cell in which there were multiple chains. We performed the analysis both on the α-chain and β-chain separately, as well as on paired α and β-chains, in each instance requiring exact matching of the CDR3 amino acid sequences.

    Modelling infection outcome on HLA-DQA2 expression

    To test whether cell-type-specific expression of HLA-DQA2 at the day before inoculation was predictive of the infection outcome of the challenge experiment, we performed logistic regression modelling using the ‘glm’ R package. For each cell type shown, we fitted whether or not a sustained infection would occur on the mean expression and fraction of cells expressing HLA-DQA2 at day –1. For cross-validation, we used the ‘roc’ R package and performed five 1:1 test-train splits.

    Multi-flow re-analysis

    Samples used to assess MAIT cell activation were collected as part of the prospective healthcare worker study Covidsortium. Participant screening, study design, sample collection and sample processing have previously been described in detail61. Participants with available PBMC samples who had PCR-confirmed SARS-CoV-2 infection (Roche cobas diagnostic test platform) at any time point were included as cases. A subset of consecutively recruited participants without evidence of SARS-CoV-2 infection on nasopharyngeal swabs and who remained seronegative by both Euroimmun antiS1 spike protein and Roche anti-nucleocapsid protein throughout follow-up (16 weeks of weekly PCR and serology) were included as uninfected controls. The study was approved by a UK Research Ethics Committee (South Central—Oxford A Research Ethics Committee, ref. 20/SC/0149). All participants provided written informed consent.

    Multiparametric flow cytometry was performed as described previously and data related to immune subsets other than MAIT cells were previously published14. PBMCs were plated in 96-well round-bottomed plates (0.5–1 × 106 per sample) and washed once in PBS (PBS; Thermo Fisher) then stained with Blue fixable live/dead dye (Thermo Fisher) for 20 min at 4 °C in PBS. Cells were washed again in PBS and incubated with saturating concentrations of monoclonal antibodies against markers to be stained on the cell surface, diluted in 50% Brilliant violet buffer (BD Biosciences) and 50% PBS for 30 min at 4 °C. After surface antibody staining, cells were resuspended in fix/perm buffer (eBiosciences, Foxp3/Transcription Factor staining buffer kit, fix perm concentrate diluted 1:3 in fix/perm diluent) for 45–60 min at 4 °C. Cells were then washed in 1× perm buffer (10× perm buffer Foxp3/Transcription Factor staining buffer kit diluted to 1× in ddH2O) and saturating concentrations of intranuclear targets (Ki67) were stained in 1× perm buffer for 30–45 min, 4 °C. Cells were washed twice in PBS then analysed by flow cytometry using a LSR II flow cytometer (BD Biosciences). Flow cytometry data were analysed using FlowJo (v.10.7.1 for mac, Tree Star). Single stain controls were prepared with cells or anti-mouse IgG beads (BD Biosciences). Fluorescence minus one controls (FMOs) were used for gating (see ref. 14 for FMOs and detailed gating related to these stains). Note that the frequency of MAIT cells did not differ between controls or PCR+ as previously reported14.

    Immunofluorescence confocal microscopy

    As previously described62, SARS-CoV-2 and mock-infected human nasal epithelial cultures grown at an air–liquid interface were fixed using 4% (v/v) paraformaldehyde for 30 min, permeabilized with 0.2% Triton-X (Sigma) for 15 min and blocked with 5% goat serum (Sigma) for 1 h before overnight staining with primary antibody at 4 °C. Secondary antibody incubations were performed the next day for 1 h at room temperature. Cultures were then incubated with AlexaFluor 555 phalloidin and DAPI (Sigma) for 15 min before mounting with Prolong Gold Antifade reagent (Life Tech). Samples were washed with PBS-T after each incubation step. Images were captured using a LSM710 Zeiss confocal microscope and rendered using Nikon NIS Elements. Human nasal epithelial cell cultures from three individual donors (one child <12 years old, one adult 30–50 years old and one adult >70 years old) were stained and 4 technical repeats used per donor (mock and SARS-CoV-2 infection conditions). Representative images of immunofluorescence staining, taken 72 h after infection, of nasal epithelial cell cultures from the older adult and the child can be seen in Extended Data Fig. 5b and Extended Data Fig. 9a, respectively.

    Transmission electron microscopy

    Cultured human nasal epithelial cells that were either SARS-CoV-2-infected or mock-infected were fixed with 4% paraformaldehyde 2.5% glutaraldehyde in 0.05 M sodium cacodylate buffer at pH 7.4 and placed at 4 °C for at least 24 h, as previously described62,63. The samples were incubated in 1% aqueous osmium tetroxide for 1 h at room temperature before subsequently en bloc staining in undiluted UA-Zero (Agar Scientific) for 30 min at room temperature. The samples were dehydrated using increasing concentrations of ethanol (50, 70, 90 and 100%), followed by propylene oxide and a mixture of propylene oxide and araldite resin (1:1). The samples were embedded in araldite and left at 60 °C for 48 h. Ultrathin sections were acquired using a Reichert Ultracut E ultramicrotome and stained using Reynold’s lead citrate for 10 min at room temperature. Images were taken on a JEOL 1400Plus transmission electron microscope equipped with an Advanced Microscopy Technologies (AMT) XR16 charge-coupled device camera and using the software AMT Capture Engine. Human nasal epithelial cell cultures from three individual donors (one child <12 years old, one adult 30–50 years old and one adult >70 years old) at 72 h after infection (mock and SARS-CoV-2 infected) were processed and imaged. Representative images 72 h after infection from SAR-CoV-2-infected nasal epithelial cell cultures from the older adult (>70 years) are shown in (Fig. 2), with additional images from the child (<12 years), younger adult (30–50 years) and older adult (>70 years) can be seen in Extended Data Fig. 9b.

    Serum antibody assays

    As previously described7, serum samples from each participant were taken and the antibody titre measured using two assays. In brief, the SARS-CoV-2 anti-spike IgG concentrations were determined by ELISA (using Nexelis) and reported as ELU ml−1 (Supplementary Table 1p). Neutralizing antibody titres for live SARS-CoV-2 virus (lineage Victoria/01/2020) were determined by microneutralization assay at the UK Health Security Agency and reported as the 50% neutralizing antibody titre (NT50).The LLOQ was 58 and 50.2 ELU ml−1, respectively, for the microneutralization assay and the spike protein IgG ELISA. For the median (IQR) per infection group, see the summary study metadata table in Supplementary Table 1g.

    Reporting summary

    Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.

    [ad_2]

    Source link

  • Role of IL-27 in Epstein–Barr virus infection revealed by IL-27RA deficiency

    [ad_1]

  • Latour, S. & Fischer, A. Signaling pathways involved in the T-cell-mediated immunity against Epstein-Barr virus: lessons from genetic diseases. Immunol. Rev. 291, 174–189 (2019).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Taylor, G. S., Long, H. M., Brooks, J. M., Rickinson, A. B. & Hislop, A. D. The immunology of Epstein-Barr virus-induced disease. Annu. Rev. Immunol. 33, 787–821 (2015).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Dunmire, S. K., Hogquist, K. A. & Balfour, H. H. Infectious mononucleosis. Curr. Top. Microbiol. Immunol. 390, 211–240 (2015).

    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Tangye, S. G. & Latour, S. Primary immunodeficiencies reveal the molecular requirements for effective host defense against EBV infection. Blood 135, 644–655 (2020).

    Article 
    PubMed 

    Google Scholar
     

  • Hirahara, K. et al. Asymmetric action of STAT transcription factors drives transcriptional outputs and cytokine specificity. Immunity 42, 877–889 (2015).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Kastelein, R. A., Hunter, C. A. & Cua, D. J. Discovery and biology of IL-23 and IL-27: related but functionally distinct regulators of inflammation. Annu. Rev. Immunol. 25, 221–242 (2007).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Huang, Z. et al. IL-27 promotes the expansion of self-renewing CD8+ T cells in persistent viral infection. J. Exp. Med. 216, 1791–1808 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Munz, C. Latency and lytic replication in Epstein-Barr virus-associated oncogenesis. Nat. Rev. Microbiol. 17, 691–700 (2019).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Shannon-Lowe, C. & Rickinson, A. The global landscape of EBV-associated tumors. Front. Oncol. 9, 713 (2019).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Callan, M. F. et al. Direct visualization of antigen-specific CD8+ T cells during the primary immune response to Epstein-Barr virus In vivo. J. Exp. Med. 187, 1395–1402 (1998).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Karczewski, K. J. et al. The mutational constraint spectrum quantified from variation in 141,456 humans. Nature 581, 434–443 (2020).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Sprecher, C. A. et al. Cloning and characterization of a novel class I cytokine receptor. Biochem. Biophys. Res. Commun. 246, 82–90 (1998).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Pflanz, S. et al. WSX-1 and glycoprotein 130 constitute a signal-transducing receptor for IL-27. J. Immunol. 172, 2225–2231 (2004).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Chen, Q. et al. Development of Th1-type immune responses requires the type I cytokine receptor TCCR. Nature 407, 916–920 (2000).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Owaki, T. et al. A role for IL-27 in early regulation of Th1 differentiation. J. Immunol. 175, 2191–2200 (2005).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Yoshida, H. & Hunter, C. A. The immunobiology of interleukin-27. Annu. Rev. Immunol. 33, 417–443 (2015).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Artis, D. et al. The IL-27 receptor (WSX-1) is an inhibitor of innate and adaptive elements of type 2 immunity. J. Immunol. 173, 5626–5634 (2004).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Schneider, R., Yaneva, T., Beauseigle, D., El-Khoury, L. & Arbour, N. IL-27 increases the proliferation and effector functions of human naive CD8+ T lymphocytes and promotes their development into Tc1 cells. Eur. J. Immunol. 41, 47–59 (2011).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Charlot-Rabiega, P., Bardel, E., Dietrich, C., Kastelein, R. & Devergne, O. Signaling events involved in interleukin 27 (IL-27)-induced proliferation of human naive CD4+ T cells and B cells. J. Biol. Chem. 286, 27350–27362 (2011).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Pflanz, S. et al. IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells. Immunity 16, 779–790 (2002).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Pagano, G. et al. Interleukin-27 potentiates CD8+ T-cell-mediated anti-tumor immunity in chronic lymphocytic leukemia. Haematologica https://doi.org/10.3324/haematol.2022.282474 (2023).

  • Harker, J. A. et al. Interleukin-27R signaling mediates early viral containment and impacts innate and adaptive immunity after chronic lymphocytic choriomeningitis virus infection. J. Virol. https://doi.org/10.1128/JVI.02196-17 (2018).

  • Pratumchai, I. et al. B cell-derived IL-27 promotes control of persistent LCMV infection. Proc. Natl Acad. Sci. USA https://doi.org/10.1073/pnas.2116741119 (2022).

  • Devergne, O., Birkenbach, M. & Kieff, E. Epstein-Barr virus-induced gene 3 and the p35 subunit of interleukin 12 form a novel heterodimeric hematopoietin. Proc. Natl Acad. Sci. USA 94, 12041–12046 (1997).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Devergne, O. et al. A novel interleukin-12 p40-related protein induced by latent Epstein-Barr virus infection in B lymphocytes. J. Virol. 70, 1143–1153 (1996).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Niedobitek, G., Pazolt, D., Teichmann, M. & Devergne, O. Frequent expression of the Epstein-Barr virus (EBV)-induced gene, EBI3, an IL-12 p40-related cytokine, in Hodgkin and Reed-Sternberg cells. J. Pathol. 198, 310–316 (2002).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Larousserie, F. et al. Analysis of interleukin-27 (EBI3/p28) expression in Epstein-Barr virus- and human T-cell leukemia virus type 1-associated lymphomas: heterogeneous expression of EBI3 subunit by tumoral cells. Am. J. Pathol. 166, 1217–1228 (2005).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Kang, M. S. & Kieff, E. Epstein-Barr virus latent genes. Exp. Mol. Med. 47, e131 (2015).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Tosato, G. et al. Monocyte-derived human B-cell growth factor identified as interferon-β2 (BSF-2, IL-6). Science 239, 502–504 (1988).

    CAS 
    PubMed 

    Google Scholar
     

  • Tosato, G., Tanner, J., Jones, K. D., Revel, M. & Pike, S. E. Identification of interleukin-6 as an autocrine growth factor for Epstein-Barr virus-immortalized B cells. J. Virol. 64, 3033–3041 (1990).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Chehboun, S. et al. Epstein-Barr virus-induced gene 3 (EBI3) can mediate IL-6 trans-signaling. J. Biol. Chem. 292, 6644–6656 (2017).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Puel, A., Bastard, P., Bustamante, J. & Casanova, J. L. Human autoantibodies underlying infectious diseases. J. Exp. Med. https://doi.org/10.1084/jem.20211387 (2022).

  • Kisand, K. et al. Chronic mucocutaneous candidiasis in APECED or thymoma patients correlates with autoimmunity to Th17-associated cytokines. J. Exp. Med. 207, 299–308 (2010).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Puel, A. et al. Autoantibodies against IL-17A, IL-17F, and IL-22 in patients with chronic mucocutaneous candidiasis and autoimmune polyendocrine syndrome type I. J. Exp. Med. 207, 291–297 (2010).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Nanki, T. et al. Suppression of elevations in serum C reactive protein levels by anti-IL-6 autoantibodies in two patients with severe bacterial infections. Ann. Rheum. Dis. 72, 1100–1102 (2013).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Puel, A. et al. Recurrent staphylococcal cellulitis and subcutaneous abscesses in a child with autoantibodies against IL-6. J. Immunol. 180, 647–654 (2008).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Bastard, P. et al. Autoantibodies against type I IFNs in patients with life-threatening COVID-19. Science https://doi.org/10.1126/science.abd4585 (2020).

  • Bastard, P. et al. Auto-antibodies to type I IFNs can underlie adverse reactions to yellow fever live attenuated vaccine. J. Exp. Med. https://doi.org/10.1084/jem.20202486 (2021).

  • Zhang, Q. et al. Autoantibodies against type I IFNs in patients with critical influenza pneumonia. J. Exp. Med. https://doi.org/10.1084/jem.20220514 (2022).

  • Fournier, B. & Latour, S. Immunity to EBV as revealed by immunedeficiencies. Curr. Opin. Immunol. 72, 107–115 (2021).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Kawamoto, K. et al. A distinct subtype of Epstein-Barr virus-positive T/NK-cell lymphoproliferative disorder: adult patients with chronic active Epstein-Barr virus infection-like features. Haematologica 103, 1018–1028 (2018).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Alosaimi, M. F. et al. Immunodeficiency and EBV-induced lymphoproliferation caused by 4-1BB deficiency. J. Allergy Clin. Immunol. 144, 574–583 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Rodriguez, R. et al. Concomitant PIK3CD and TNFRSF9 deficiencies cause chronic active Epstein-Barr virus infection of T cells. J. Exp. Med. 216, 2800–2818 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Somekh, I. et al. CD137 deficiency causes immune dysregulation with predisposition to lymphomagenesis. Blood 134, 1510–1516 (2019).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Hoshino, Y., Nishikawa, K., Ito, Y., Kuzushima, K. & Kimura, H. Kinetics of Epstein-Barr virus load and virus-specific CD8+ T cells in acute infectious mononucleosis. J. Clin. Virol. 50, 244–246 (2011).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Martin, E. et al. CTP synthase 1 deficiency in humans reveals its central role in lymphocyte proliferation. Nature 510, 288–292 (2014).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Yamazaki, Y. et al. Two novel gain-of-function mutations of STAT1 responsible for chronic mucocutaneous candidiasis disease: impaired production of IL-17A and IL-22, and the presence of anti-IL-17F autoantibody. J. Immunol. 193, 4880–4887 (2014).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Toubiana, J. et al. Heterozygous STAT1 gain-of-function mutations underlie an unexpectedly broad clinical phenotype. Blood 127, 3154–3164 (2016).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Izawa, K. et al. Inherited CD70 deficiency in humans reveals a critical role for the CD70-CD27 pathway in immunity to Epstein-Barr virus infection. J. Exp. Med. 214, 73–89 (2017).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Durandy, A., Kracker, S. & Fischer, A. Primary antibody deficiencies. Nat. Rev. Immunol. 13, 519–533 (2013).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Fournier, B. et al. Rapid identification and characterization of infected cells in blood during chronic active Epstein-Barr virus infection. J. Exp. Med. https://doi.org/10.1084/jem.20192262 (2020).

  • McStay, G. P., Salvesen, G. S. & Green, D. R. Overlapping cleavage motif selectivity of caspases: implications for analysis of apoptotic pathways. Cell Death Differ. 15, 322–331 (2008).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Dobin, A. et al. STAR: ultrafast universal RNA-seq aligner. Bioinformatics 29, 15–21 (2013).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Anders, S., Pyl, P. T. & Huber, W. HTSeq—a Python framework to work with high-throughput sequencing data. Bioinformatics 31, 166–169 (2015).

    Article 
    CAS 
    PubMed 

    Google Scholar
     

  • Love, M. I., Huber, W. & Anders, S. Moderated estimation of fold change and dispersion for RNA-seq data with DESeq2. Genome Biol. 15, 550 (2014).

    Article 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • Edgar, R., Domrachev, M. & Lash, A. E. Gene Expression Omnibus: NCBI gene expression and hybridization array data repository. Nucleic Acids Res. 30, 207–210 (2002).

    Article 
    CAS 
    PubMed 
    PubMed Central 

    Google Scholar
     

  • [ad_2]

    Source link